, 9 3 99@@PHC@@T*@P0i<=:p8 K7a4  Cx8mmI@$<0O!T4: eI0)00000 000% 0 06060604P PEp` P%$Zᤅԁ Q@B'yp@BBB@B|џNOР adџNOР a@tt@ttttttttttttПNOР a@`ПOР a^`|IIIxp@-,O~P~P,#ODO00PpO = p  @@`, `Phparmv4v4D tz l@aT t^&8IƤ 쨼܄܋`*R̸zLDdojrbJk4vnbvӒ|~^Tc-;¦֎&\EnL֒cznƆۤVn( td$   " @   V G Tt l   4 /( | d ,  <$,(\ "LE1T< <|| Mt H>:%N4 CUpU,,mmUG((GpU,,U,UU,֡,mmp(pU, &vs"N5zN܎~= ,,UU,,,*m,p(pU,,֡,m֕(pU WP>"N5RRzNX ,U,֡,mmGpU,ҕUU,֡,,mUGU,Yv->"N5RR:M$ (U,֡֡,,mUpU֡ДU,U,,,ppU֡ֈw8>iN5500JH< ,U,֡,֡,,,GpU,֡(G,,U֡,,UpGp,,CTH>"5MEuJ{= (+ ,,UU,֡,,Upp,p(GU,,,UUppppUm֕, C6008Enux7? p,,U,U,UppppUmmUGp,,,,,֡,UUUUUUmKU gMbxx#gK+G C,,,,֡UUUUUUmUUUU,,,,,,,,,U,,,,m**UU m~dS66cmk} ɡ,,,U,,,,mmUU,,,,,,,UU,,mmU, Km٧lm*Be, ,,,,,,UU,,mmUUU,,,,,U,,֡,UU(C*mmmmmmBe ,,,U,,,UU,,UUUU,UC(emmm*B ,,,UUUU,UpppppUU,UUUUpppːp, BЃee} ,UUUUppppppppUUU,,UUUUUpUUp peG m,UUUUUppUUpppU,,,,,,,UUUUU˕,,UU ֈ +mUUUUU,,Uːp,,,,,,U ?B +֕,,UUUUU֡,,,,,,U,,,˔ eBkkBkkk U,,UUUmmm֡,,,,Upp, 2kBkп**m4 Uppp˕,m֡,,,,UUU,U˕ ,eeBk* 4+ UUUUUUU2,,UUU CGkB쿣 + ,˕,UUUUUUUmUUU,,UUUU4 壃m +4 UUUUU,UUUU,,,,,,U, peC}Ɉ C,,U,,,UUUUUUU,,,,,, B44+ ,,,,,,,,UU,,,UU,,,,,mC؀2 ֡,,,,UUUU֕,,,,,,,, B +C ,,,UUUUU,UU,,UUUpɀ+ B UːpUUU,,,UUUUGU +Cmk( (UGGpUUUU,,,,,,,Up++ekG 4 GpU,,U,m,,,,Upp } e ؈ ,GGmU,С,,,UUU,,˕ ( + UGU,֕Um,,,,Uː,p 4 ek + GU,Gpm*GGp,UUUUUG CBk 4 ,Gp,֡,U˕m֐GG,,UUUUUp ؕBG C}C ˔pU֡,,֡GU,֡UUUUUCCek?؀4+ U,֡,,,,p,֡,UUUUUUUD>]yeBe4 CpU֡,UUppU,֡UUU,,2]iIBkN! 4ػ,,UUU,,U˕,,UpUmHjIi]/Y}ek~f 4CZF',U,,,,,U,U,*r;V)]I]>if4eB>Zf f[sL,,,,pU,,pU`JHJ)s]IIII:WpBsPy f7>ο,UUU֡U`>---3]IIIIIY (J-Px.WQW1MP-],UUpUUUm,֡UpuP>III]IIIIIiO BJ:Pb#_)3]]sUUUUUU,,,,֡UpphuPIII]II]II]i]% *KPsvHuub3I]]UUUU,,,,,pp_-IIIIIIIIIII]I"Zy ec_)--))vP-II>I\UU,֡,,UppU,`v]IIIIIIIIIIII]܋ 2)-3---j-3]IIIs\,U,֡,,,Uː˕,mAo>IIIIIIIIIIII>N8 UeB)-]]IIIIII>III\V֡UUUUpp,,o3IIIIIIIIIII]]i"b4keekՈ[)]]]]]]]IIIIIIIqmmUUU,Uppp,Av]]IIIIIIIIIII]]^eee #)3I]IIIIIII]]]-\m,U˕UppU,_v3]IIIIIIIIIIIIII>/heek OP>IIIIIIIIIIiiI]-FUppUUpGpu-3IIIII]IIIIIIIII]-eeeeek+ )3IIIIIIIIIII>>^A'UGpUUppU,m9j]]IIIIIIIIIIIIII>0wɔ,֡UGC j-III]]II]]JAU(GpUGpp,9vPP-->>]>]]IIIIPuW yv3II]II>j)ߗmmUG((GpU,,U&E_0Hoo))j--]IIIII-vnw[f y9P]]]]>-)v7mm,(pU,U,އ@nxx9o--333v0dT[f f 4#oP--j)ox,,mm,GpU,ҕUU,֡mm6t6#xbJ)b#T1W+,,,,,,,}ʷuoovoxSm,mUpU֡Д,֡U,֡,hlww@Sn@T1׬UUU,,,m|T@nn6,,,֕GpU,֡(G,,U,,,,,Up,TT1*U,,,,,,,,m*O1.୷ȴ,,,pp,(G˕,U,֡,Uppp,cʳm,UU,,,,,,,,,,p蕕֡U,UppppUmmUpGp,,,,,֡UUUUUUUU,,UU,,Up,mmm,,֡,UUUUUUUmUUUU,,,,,,U,,,,mm,UUUUUU,,,,˕,,,,,,,,U,,,,mmUU,,,,,,,,U,,mmUUpː˕,,֡,,,,,,,,,UU,,mmUU??<!||@)??<| ǀ  `0@8G#x0pO@@? x 5e.en+eA`)aff3wwwwwws33:33wwwww'www3:330UP3wwwrr'ww3333wX7wr""ws337w3Vf7wr"ws333330Uffffwr"ws:33333ffffw""w333333:w3ffa7""w3:333:""w:fff7""w3:333:PPr"""sffaw"'s333:q"Pwwr""'1faw"w3:333p.pDB`""""""'1ffar"w3333w0@THT@2""""""1ff7"'s:3:wPFTPBff2""""'1ffr"w3370P&TD""'far's317p""#f7"w:3 ݽE"""qffr'3s`ې"""'fa7'3` ΢"""zffw:3f`۹ar"""fa7:[ݽ"""#f::p[ݰ`.f2"""6f33::`"^hc"""*ff33h+""nǦ2""'f3:""$` !hc"""qf3:q&""O@ """"'31hTB"""DH""!j"""1:360OD""$D"r"2""'13hjOOB$OP"sr&c"""sOODO@'"hUr""3:DOOOa":&Xg""aaz71DOD*rhU""fa3stDODDDDD"&"fa7:ff rDODODD""$*"hXc"fsw1faDOOODB"@U'xrfwsfavPOODOB@hUX:#fwzfOOODOD$&UU#2ja7w1ff`OOODOONeUXz&aa2'fa1`ODDODOD&UU'3'har'fjqDDODODUV"'"6f"#csDDDODOOO(UX""!'zfuDDODOODO:Xgr"'7'zhpDDOOD#xw"':rsqhf2PODDOODDU:!w'ssr36arDDDOODOODUUUUUUU'wha#q:'6a DDOODOOAYXw'26c#qf'j POOOODDOODOOAh2"s*1fzfc OOOODDOODOOIej"#r'hfgpOOOODDOODI.e7r'7hfgЄDOODOODOi왈cahar"zhfDOOODDOODOL &ff"#fЏDOODOD!f'eXg"'(hDOODf"qU""v1DOOODD "#hU""zqODOOODېݸc"'Uw""(DOOOODOO"ۻՆ""w""+TOOOODD"ݻ݈r'"gr"3-OOOODDO"ۻ݈'rh2"67-OOO"grw87"&r+OOOD%2sv3"*"+ݰTOOODݧs&zr'"+DOOD@#!hr""+DOOODB݇''fg""r{ݔDDDDDDݸ""zh""7{۵DDDDGhXr"'r"۵ ݹX"62"a;۹ ݹzhb''ݻۻ1he##g'ݻhb1fbsc'3eUU hUXffffb3'zXS*g1hUXYXhfafbfhb'wxU"%UUj*b'78UYXfchgffhrwxX#2UUsfbz8X'UX28fafafh"qXb#hfc*(Uaffhffwhfbfhab""Ur7afU#qfa!fff1ar"hUww6hUXsrvhf6c&6ffva""8X7"!h1hUU""hh6!hf&fa6fh'"(r*f"6UUX7:ffffgqhhavfjfw"&7qf3*UUsffhcfahjvfjfjtTc b<*8" X 8b123PQRSTUVWXYZp s0tuvz  Ppn@-@Plp`  P,@P@@T 0-S   U0E0|B0S 00 00PPE<<0  ~| l0 bbGGt 00A-<0p M0*_(1랈,, :p,d,\\0\` 00H0RP@ 0S 00 GGi@1udG00뿾T@0S( 0("S# "<S dd @P  0SYT "4S P nE4c@cHcЍ@-%0S 㭜 㢢PVE(&p0`0PS  0~s0c0@0 0~s0c00 0~s0c0l0 0~s0c0L0 0~s0c0,,CCbpclGhGGtccccc-00)@ P_(Lp$ ||0 00L\!00F0DD 0 >0   0  51 0 00+0 ' 00"0  000  00p0  ` 00L0  < 0000 0  00 0)CC 0@-0@0)@`R P񟗁4`(P0 P0 l!0P00f1Pa 01PZ 00!00T1 PO !000Jt1 PE d!000@L1 P; CRF 2R] 0RZ ! % @!,0(0! 0(0  H o,B k,@" g, c, _, @Z,!     0(0$  0(0%p  , 0mZZPe quA-1M8` ]8Pxxxp0\@c@OT 0P00AWT 4Aa T Ab T Ab T Ad T A\ T APT <A0@T  +0<S x!0A ,+@T 0D `P@REXfdftffffff| 4f<Ѝ4 0 0  408:@-P  Pxx@0000C0  \P000 ( (000C B000pq0 8:G-7#MCZ0` 00P@p`pq 0@00"0w 00 = B00 V B00  B00 P@0a0@Pp0b000 0r0 @00p000@0+p^ B0a0p@P @0=0C?C 00 B00 000p@PP`0V00S$2`Lp0Ÿ"P `00C 00 0@^TpKp0!P `00C 00 0@^Tp@p0@@@!@P `00C 0 @^Tp0` p P0@0A?b 0 ?C 0 00p0 0 0 0o0 p0 P 0C@00 0 00 0fpq:0p@0@0)@000) Ѝ0@- @0P0 00 00 @0  0@@-0@0)000)0@-,A00岽 00 @P㨽@T0 T? 0@ P㖽@T0T?P@00 儽 0@ }@T0T@?, 000 0000C00&.g,, 4000@$%$@h8\IHMB HMBHM BHMxB<@     O<P 5 P 55 @ h &W@dQ&W HM!H4P【! ! 0"!@iHMpqHP4@`Da-*'$ !       @> O@iHMTp`HP4@  ,!@i|IIIPmxIIHM(@<0`C pD 0! 0""HM@<`H$pDa-*'$ !       @> O@EHMA<`Hp㸐⭦ኦ㸁Az! HM(B<`H p! "0  @iЍA VVV01@ !i(0\0X", 0C #6L0"P<00T0a>0#6P0!0^0\0s3c#6T0H 㪷Hp@-@,x0S zK@-p`@0$* !0PS  7@04?0;1$%/ `0. "Q:#: 0bP H"lkPmoG-p`&: 1@QC  0Y7(14?0;1&%// Q * 0 !R1:#:PL@2尀P $0 8 2R!"! 0 0bP !lkPmo0@-N@PeP 0Q1  0!0dS ,0 d@0b,000E-p`P: #:S'P0 S: PU 0S &@ !Q Q Q <$D8$H4$L@ G-pMP :!#:SA  00S: Y 0S 9 @ ` 0 P0 S6667``dP'\ %XXL0'X`hdlT'T 0 0 0  0Ѝ0!P~=80~=80 !4 ~-8 ~̀80 !3<0 3 2Q 8(808880Pp~ 80# Q |88880PpG-`=80M =40~}8p=40~} 8p @ Pj/01 P 0AQ Q Q 3Q !Q .Q aQ ( Q Q # 3 RR 6CR5  R 6CR& 3R2 6R8 3Ra 5CRE 6RN \3Rc 6CR[ Re E@ N@@<@ E@$@3@ <9@ (@`@#@ ,@@@ #@0@>00@ @0@`>00@ @0@`>00@ @@@ @@: S   0000`0 /P  l0#0f: Sd 0  :#:0:#:0c0 P0K0#0F E # hh hhh@h0hP P Q@ ,R0%TQ0EP`UU33ppPP k P0#0 02, A3sQ 000 S 1  0PUpA P 08 0PpPU "ЍA-R@BU@Pv4T op p@TUkp@-PMP, 0w00sQq A4!x#0A@T \0STc P^<0T`[ X0 A/0Q3 Q0Q C/0Q2 Q0Q X17 0 <000 R0 0-t 00R 4 808084040 R|0|0| Rt 0x0t`$480808 4@8@t 0|0x0S0|@t0x@ 0 0S P<0t `R0@SAA8BBBBCDClCDEDECCD8DDEDDEDEDEDEDEDEC  P 0   03Q"0000S0?SJ\*G\~=80  0  003S  00S /RJ\*G\~=80 Pp @UP 0 00HP["z0S} T" 0H0q@Us0 " 00F"HPi~̈́8 0H 0 3R  !^ V~ 8 0Ht 0z 0 3R  t 0z 0 3R ܵ\ 200@U,000"HP4 808084040 R|0|0| Rt 0x0p0t0H480808 4@8@t0P|Px0S0|@t0x@d Ѝp@-L@0000S0 H0 "HP  0H0G-@P`0pT*00S $@ T*00ST:20 T ㌲0 02  0 DP 0 ?0< 0,0者8mJkHlkPmHm4m@-@  0K0C"S'GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG000G- `MpDJ X# R vPV`F` @ 0P@SZ\ 100 R0 p0v S V  0v SVlIЍ@- @ S0 P0 0@1D1-(0(  Q1 00D1I l@1 00  00  J@-@0 S S (1: 00 0@ D H ll 0!  JG-1M0@0Qp00  P0 n0SA@\   T 0 S l@1T`a( T 1L!0L00P00"22 0   00) `Pp p  "P Ѝp@-Q`M; 0P 0 3R@  K^ '07<0  )+> P"20   00) 00_  P Ѝp@-@Q(M , 003Q 00: 00R4 0  P-0 0  $\T   0T0^0S , 003Q   00P 00\   00 0(Ѝ0@-@ 0 @ 0@0  @ 0 @0  @ 0@$0  @ (0@,0 @ 00$@40 ( @ 80,@<0 0 @ @04@D0 8 @ H0<@0L @ @ H00@0Q \PP  j00p@-`M4PL@; 0 \0 3R  20 Q+T 9P%07<0  )+>"20   00)WP P  # %Ѝpp@-`M4PL@2 0 0 3R+  P%07<0  )+>"20   00)P P   Ѝp0@-P 00P@0P 0P@0P 0P@$0P(0P@ ,0P$00P@(40P,80P@0<0P4@0P@8D0P0p 00)+ @00)T 0, T* 0H@0XPH@pT T H 0T @  t0\ \2 t+D2!2!   t11"0CP T 0@PʱPN\0S 0DS8(](](](]`](]`]`](]`]`]`]`]`][[\\\\`]`]`]`]`][`e>Pt00H@2H!|DP  R 0PϊD0 10 + ?0S <R 0CR  r 000<0D 0C <00 `W 0S @0 rR 0R<0D 0C <0W Ѝp@-@M `ᐬPP, 0 03Q ]\ PЍpp@- `P ML@ 0 0 3R  #^0 ` 0R057P 000P PX`U ] Ѝp-, M 003Q  ^ ЍA-P`M(p (2P/P P P   @ ?@@\ @<0 0003S 00P V@P> 0@S9daab$b  06@rR@\m @, 003Q  ၮ^Z 0 ,0 p@N@I @CAP?0@S;hbcc,cR R   0D@P-, 0 03Q00 @<0 @R  0(@ K@  @ @@Ѝ- 4%Q-4%- 4%AA-`pᚫ@Pt 0Ш@{E- @`M$p<  0B 0 3RP@  T00R^  0 00h 0n\  +0nЍE- @`M$p<  0B 0 3RP@  T00R^  0 00 0n\ *`nЍ0@- 0@Sn00\ *T 0P 0)0!0S0!C)AK, 0RϠ 03QP ᇬ 0)0!00!)AnK\ 0DNndGE-!0Sn00h\ *X <0 0 03Z(q 0)0!0S0!C)A5K` F@ P 0P@b  <@` 0P@c 3@` 0P@c *@`# 0P@c$p !@`,0 P@b0)000)AKT HNndGHRHHH-, 00@-@AP`\ @Dd0dd$01l2ls111"$!b#!  a0`Qu-T0^<0\ R000 c,0 <\B" 10 14R @prPmsr@-, T0@S 00S n/\ H%@,s0 >%Ls 0 7%ts P8|8|8|8|8|8|8|8|0|0|0 R MJ- P||||||||||0 R 8 J- P|||||||| } }0 R/J- PL}L}L}L}L}L}L}L}`}`}0 RtJ-v0J1`($P004 OA-P`0HJ V 1fD pB .80 .<0p0  0 .40 0p '40@Q :Q D@ 0H H@l 0D@ 0f@0$@000!f00OPm`0Ġ! O0@-0!M000C 0 000  0PUS0SPPU- @@T@0A@B C0@0 @0h hh@D0000 0P 20H03@@F s  Ѝ0-(0((  >0J J$JP(J0  1S@0@-@P@0P00000@-@P@ P 0 0000@-@P@0P00000@-P@P @00@-P8#HP @00@-P@P P0p@-`XH%X$HM 00@@  Ѝpp@-Pa@@M  s 0,P0Ѝp@-<0@T 0(0< @T@K| @- @01C  0 \10 BAl0@20W0008 0000,@1#o<@s+p@-R@H "0\0ZU< (\ 0( 0ZgXL\`0 P0I@@pp@-H BhX `0^P0ZP> (^ 0( 0Z"N0^0pP@-@  P ;@T 0@A@@H0000@-P00) 0000@AT 3\@VpU03C 00)00@-X@0P@ %>$ 0 0 Br%.4P0@ U0@-@P0@ 0p@-0`AP #@C`cD}D D@D @`F p@DQ @- @@TZ 000C0p@-``F@0@QPF@A @ETP@0@p@hQ,J0P @,Jp@-`P" :PPU0e3 ?IcTTyo $40 01( 0p@dp@Q t,J0@-@00S0 P0NPEu 0@ Br%.4ll 242` M02T+,LL 2(DD 2$<< 0@TPU(6(8xX,1p@-@4`PU  000spQ@RE-p 0PS'`᠀@T 00 $00C0qp@T 00 $0 D0C0p0 SmPm@-`@(p(P8@TPmn@-@\m@-@ Jr0p P0`1# @R1 100p` R@0EP(A0@SH @ 8 0 @iC> 0?0O@㣛K㟛;D 12 4KjF%5Z?  1z846S46S  V* 02; +0V0:XfF%:V   08!4vV* 0 000 V04:%: 0 >C> 0R?0O@>K:;D 1p0 4KjF%5Z?  ,0z8 V*RQFPmЍ@-<02S 0S<0 P@0p0`4@PUFPm  3Ġ!Ɍ 0 10A S:6 :6 P0A S : : P/::6 P:: Q: : : : Q0?P6 P6 2?: QO--"ҀґRB_4 1   " $) 01O i )i? :!.  P.U.  :@ )Q@-)+R RxXQ @- IntelStrongARM-110QQG-)  DDAM i0  Y*0S 0gd f  0i0S6#00 0f 0 &6 PR0@pT 00 l0$00C0T D , !4  ,FPmm?0;1P PDF 0fpWv#f0S 0 8JPT:&j0jV:0S  p4 PR ):2S 04 R0S ) 0S. 0 PYl: ,yPm mЍE-@P0CP#3UppW \0\ @00Pd.[P  `0-P Q[J[-0 M00[\0yTJЍp@- ?  B?""2T HPH`@_  )00C0   )TpnTJ@2 0S 0  \A-p<0` 20p 00 !p 8#8SL(L$L"L!L pWQ W0p00 011B_P@T 0ST 0S0R 0T_00)  B 000)@@T 0Sp@@ @AX φG0 10"20   +>^0S pTJny-0+ L1 32 P 110CP P \\ \00\P\ G-@X`@V V$ 0S!Xh h0R A?"0S Ÿ S 0S S X1 0 0 <0 R 00) X 2 S00 0) 0H S#$||||||||$LLLL0S]0H02"00   gPPTXʪ H1 32J;`q`1 QL1]P* 00)  000)P2V V <0` `\  010P 0PQ 0S τH0+.0003000 0) R0S  nQTJp@-P`0@0)"R000)pE1 0S00+Ύ0 00"20   000) p@G-`pRP`T@P04@T `0S  P`P4@ TU` G-`pRP``@\04@T l0S h0S  P`P4@ TU` G-pR<0` G|P`@04@T \0S T  `pP4@ TV\ lGL4,@ 0! R \0 SR r p0R -h :0R -f0R -~-R@4 < 0! R \0SR @pp@-P`0@M`0\ 0P 0 P H0PPPP(t PtzЍpA-pS`Ms^P pP 0 0 3R@ wPU^07<0  )+> pV V V p0  0 0  0 0 W +>"20   00)W#XX 00)+ 00)@ p 0 0 3R :\pЍ0@-0@TM 00) P2"‘0 0 00) 0 0 3R \ 00Ѝ0G-PUpM4@ 0 0 3R` Ζ@T07< W 0 0  0  0 3R ᵖ\  1R0Sw00)@ lPO+>0"2  0 "22 0   00)W 0$!Q! & 1 / 11A b!\0S  00m00) )+>0"20   00)^ @X 0 0 3R [\ @ɚ;Gk_kZ @@Ѝp@-`@M Pᾔ0@00\0  0 Ѝp0@-@, M 0P03Q  ^ 0SPD4$ 0!p R \0SR  dЍ0E-`0F?SpW V V00), ^11C⤢P@ 00WL  07< 00S S=0FVS9VpF$ڪ"131 OQ 0S@0S0B0Z  )00C0   )Qυ0 00"20   00)nTJp@-PQ M 20" "R 2^:0^#3000\1  0 @ 0 3R00S9 `R50R100S," @^:20^0#03S!@0  ` @ \:bU @, 0  03Q  -\@ ЍpA-`pQMA  0P 0 3R@  ^F07<0  )"V V V 000002"20   00)XWW <0"@  0  0 3R ɓ\Ѝ@-M00)"2  00) @ 0 0 3R ᦓ\ Ѝ@-`Sp@P(M5T , 0 03Q  g\ "T @U  w`0U0V0S , 0 03Q f\ (Ѝ<0-00) 02"2 0   00)-1(M 040P(Ѝ-L4,8 0! R \0 SR~p2 0    -L -L0S 0σ\ 2"S0S 0P 0 0`S00 -L00) <0 SL0L< @0<< @000  )00 0) c -L -L0@0) R20 0S a R 0  R*,3 R*,6 r,9| 0 Rh 0` ,=!0S00 000)(XJc_^]\_[@z -L00) R 0S0 0 0S a R 0  R*,3 R*,6| r,9l 0 RX 0P ,=!0S00 000)XJc_^]\_[ -L00)P 0S0  00 0) -LpwM'W  %hz0PKP`000 0D @<0$0 @(@ 30pcW@R< -L -L\P؂0rS0 (@0S"0w2儂  )0rS 0S S0S 00 \<0@ 0C00@ <<0@000@< R; \ `0S 0P 2"SP @<\^ @00)U 1 ! !00)4Q  0004Q00)0 00 S 0/ R 0  @'0 0)@000)Tl `0  @`Ta0Ss0@< 0@< 0$ 0<0 0Z0 a0C000Q a2B10c02A100RRQQpE.¼zzRR RHeW  S00R60S X15 0 <0 R' A/0Q ,0 Q X15 0 <0p R p<$0Q0 @04 @0<@ <0<<0@0000)  -Lu -L n -LP<0 @4 4 0! R \0S0Sp -L ^0?SM'<0P @4  0!p R \0S0 S 00 @K 0 0 3R \   -L00) 0S00@<4 00@<< @@@<00)  -L0P P0c00 -L0P P000 -L0T M , 0 0@K03Q  Ṋ^ I -L@PM 0$K 0 3Rp` {@T Z t0P$0S@PP0P ʘ0S 80B`R@0T ɚ;MbG& 0 /11A bT0S 00GP U x0 111@"c#b<#130$ 0 0 3R B\ k_kQ -LPnL@U  `X(MH0S 8#8SA(A$A"A!A R0+(U$Q$4`K+H@K2\ tS0S A\0e x0S h\\|0S L\@0S 0\ 4{c@{D{P{X{h{p{x{|{{wpl 0DQBT ,@T|{{{{{{ 0-L@@NP@2!2!2!02!2!02!2!02! \00W0^0000 p-LLD@@<04@`T ,Pe@&4@Tp{{ DR -L, 0 `Z 0-L@P 0(0L0\0h0/RP0  , 0<0040,00 nnhec@Z p -d\ d!00)  B Q000)Q R00  AOrA-H!P0!<#p!01`!R 0 S  )000   )@P3@NP  00 1 R 0 S  )000   )@\ N 0S0 00@00dA\Jr@-@ :$M@@eK0P<|rH|0| R\JЍ p@- <0\p  `<0S K?0@0 @\590P4 R/ \ ^ `0 S h0 S 0 0S0<0SK?090 ^0S`0\0 Sh0\0 S4 Rpcc 0@-d0MPP <0t ,0@ 0@`@9@@@d@0r-<0  p* 0 )   )AK@-@00)  B Q000)Q 6+ 0)NrG-<0M✂p0X  00)  000)r0Ar pMPPi `00; 00 G/ 0  VpPUV@@A ᪅ ᦅ0rS0fS0A T1 @T @D1S 0B T 0\ 0 T00epP 0daT  Q 000@TV φ0pR 吧卧 0Mpp|ЍG- 0(M@ 0W  \0Sy*'PP  /,20 )  R C)AK dP 1RN00)  000)h#0SX3 RH R00Q** P 3R0cC10 P 00)   000) 000D0S P 00)   000)D 000  *'   00&,@ 00   X0  0X0\ 00S <00l 000  *p0T 00C0\"*DD`DPD@D Q00 00 NddRdd?d00000 R \:0 0`R0P @ Pg2 0S  (@TZ 8 00\:000)@ddddЍGЍ@-`>p0P0)T @T 2 0S  (@T000)d0@-0P0)H @T 2 0S (@T000)0dG-PD"M0S2S02ű0S P2 02q0`S+ BÃPQ0 RQ02ű R 0Pᲂ 02V02`V4q2S2j 00)" R0(0P(0(0(P2M `@0 0y'yVC* 0 y@0D 'y R 00CTV-:00 0<S 0/S7S 0>S 00BDd0odddRd0`0 ,B Q 0D @ R(0`V:00 0)dddЍ-00)T R(0N0 (0S S(0(0000)d0@-P@P l0S $0 l0L0S 0Q0 R 0Q00d<0S R000Sd%\0S* Q Q $Q !R<0P\PR<0` `PR( <0 0PE-pW`O"ODT@#@R(@t@P04PU1  P( A/0P 0P X15 0 <0 R` V0`T X15 0 <0 R ` @4P Uf A-`PUpH@D04@T  oP 0S`4@T 0@-MX!@% 0 <0R 2P"2^^ 2^{2\, 1\! 1\K p1\ \ i1\- e1@T   @TG#cx!00_h1\T1@T   @T(-51@T   @T# 0  0 3R  ƀP (0 @ P T   @TPi(#ͫògE#!Cd}d}}}܍0@-`0 R T0@T   @T@ @ddp0@-!<0C 8!P@ T U X1@0 0 <0 R 000^ T C? R 0 R X1@0 0 <0 R C?.d0@0X0P^ ^ C?< 00>C/ Q  X00X00 - <0CX!@  0 <0R >tt 0CX0 P 0 P>C/C? R X00X0 , pE-!ȠA @1P`0Ⳡ V U X10 0 <0 R p1\ V A? R 0 R X10 0 <0 R A?B/1P\ \ A? 00B/A0S X00X0X 0᳀ 0UV Z d0 R 0S P0 R`XUA? RXQU A? R`1X1QE-,  A`1@pX1PL1`᳠ 0 <0 R `B?!0C 1 P 0 PA?B/A0S X00X0V 90`X 0UW Z d0 R 0S L0 R`XUA? RXQU A? R`1X1QG- h!X("x, A@4MX1 0尠᳐ 0 <0 R/1V 1 V 0 V 0 V]t1U h1 U 0 U 0 UM41W (1 W 0 W 0 W=V 0`U A/0U X00X0B?PP0W0p 00ZS Y l0 R 0 R 0 R`XZA? RXZ A? R`1X1QЍ@- `@ Pp0 003\0 ` 0" V 0  003SA? 0" Q 0  003S 0 0"  @-!Ƞ(X1"@0 0 <0 R11@P 1 P 0 P 0 P 0@\ 0 \ 0 \ 0 \0@^ 0 ^ 0 ^ 0 ^P PL0\ C/0\ X00X0>0^0 @- `@ Pp0 003\0 ` 0" V 0  003SC? 0" Q 0  003S 0 0"  <0  P A? P 0 P P X10 0 <0 R B?B0 S X00X0`0 \0S X10X1\ B? R`1X!0 X! Q<0  P C? P 0 P P X1@0 0 <0 R >> R X00X0  P@-  0@ 0 3R  E{^ 0@R0@-@P<0\QQ0@4 0@\ \0S\- <0t R p0S h h0@RX0 @D\l0@SQ PL04P P`0Sh h0R 4P@`0p P<0`@4 4 0! R \0SR`p<0`P<0h@4 4 0! R \0SRhp-\ X04 R \`0 S4 R0l0\ 0C1d0` h 0@-P0<0A TF_ 0 0 3R z\ 00@-P, X1@@0 0 <0 R0 U0 0F 0 3R >{\ Q0 0> P !R F0S  RC? P !R F0S  R@-@ 0)0!0S0!C)AzK, 0b03Q L z^0 0 )  )AyKdG@-@, `X16 0 <0 R@VP 0)0!0S0!C)AyK p 0 0 3RT z\<0 p 0)0!00!)AyKdH@-@`QP 0)0!0S0!C)AyKp|, 0P 03Q y\0 0 )  )AuyKdHp@-, @X16 0 <0 Rp@TpP 0)0!0S0!C)AEyK ` 0 0 3R P -zP<0`` 0)0!00!)A1yKpdI P@-Zό 0@ 0 3R  $y@T p@-P UML@ 0  0 3R`  y^ 'Q R1Z?0QR X14 0 <0 R U0S0S Ѝpp@-P@H`HM Kxt T20 0?$ (2c011Aa 2?2c;X0 0?$ (2c011Aa 2?2c"Q0@ 00 0 0 ?2c011A(a$ 0 2?2c011!Bb!!" , 0H 03Q  cx\ QHЍp 0S v , 2 0 P@Q<0P 0 0b108dA-`pM, X1@8 0 <0 R`O v  0S `FPP ` 0  0 3R*y@P T*`P#@@jF`V&H0W`3:`P`9PP H^wH 8@H00  p`uGFP$e `@FЍG- @XM , X18 0 <0 R t ` 0S 00!,FPP  0  0 3R*sy@P T*@P#@@E@ R ] `P00S  0  003S 00QD<0CLS00<PH@ ou 0 0 3R 9x@T " 0AR<iH0 pR: 0S[  R 0S:1SO0S $ R:01 SA, R R:0R60 R R:0RX+4 8R R R:0Q*0a 0 0GS DQ Q:0Q 0f@t 0S 0\EPP 0 0  0 3R*x@P T*0P#@@1E0S0 RyP  y 0H@C 0H 0 3R  w@T 00e 0@ (@0$\ **QS \0\ 0S S 0S<H~`~~~0\Pm$ed`(00 (  0 \:D D00, 0R@00 P 0  @0000)  B 000) 0 @ 0 0RDH 8t DHXЍA-p`M, X1@8 0 <0 R VO v  0S pDPP p 0  0 3R*w@P T*pP#@@]DpW`pUD[pP@PLDRHD(0pSK0GSD0S P0S>F9p 0@`T% (0PS 0S0GSD0S P 0S (0S00$edp@TW@T  0 00@TpЍG-`p0MPU `x@ T* 0 0 3R  duP` dP P0 U   0  003S Q  $edP\0U +x0P< U  0  003SQ dЍG-` M X!Xr 0A 0 <0 0003S0P ] p0Z%*$0 Pw @T+ 0 0 3R tP` 0 d 0 00pW:  0  003SpQ ! d0pW *0A$0 p @w0 W:  0  003SQ  ЍG-p@!PMe 0A 0 <0 0003S0P P(P, U 0`mw@ T) 0 0 3R qtPp d0P0U0  0  003S Q  dPU 09w0PU  0  003SQ ЍG- M0A 0 <0 0003S0P i P, a VD 0 0 3R" f pY)*v@ T3 0 0 3R  sP00P0 `R 3 d` P0pY:  0  003SQ 0Y *Pv0 `Y:  0  003S`Q  Ѝp@-`P PM6 R# 0 GR0D0S 0 0 3R@  s\ d`L@ 0   03Q00P ЍpG-`M$p@PQ< t <0 R "APP  , 0 03Q*!u@\ T*P#@@AP@<@ PPA2PAY *KKKL4LPL@# @ 0@ 0a@ 0@ 0L@d@ЍG-`@M1PpU 0 PUVQ @@ZrPUH 0AB @@#0P0; uu ?@ 0@ 0 3R  r\)0@`S! pW @*00< Su ? 0@ 0 3R  r\ @`p0@W:PU$e@Ѝ0@-<0@P@T 0NuP0$ep@-@0P00 00S 0000$`P* 0( (0R 0 0RU (0S0 00 0P:0T00  0S  0Sp@3$eG-`zh2h"@MZ uPW: `pe+pPeUW:  8q`pe @ wPW: p`pe0 0GSD0S wPWx: o`pe0 Wm `L pGo*  W` ` pGo0WU ` pGo@ WJ `pGoWA `pGo(X/ W6 `pGo0@tPW): o`peX W 40 pG $edȀЀ؀$(W 40 pG W 0 pG  ZP g,0@ЍG-|M` 0V. 0A( &p PW" 0 R 0@ @!w$e4p w R 0RPpW`V 0icX00DЍA-0p`V W sP0A 0S P @ sPPE@U`V$e0@-@<0TP@ !0000) 0Q0C000004 808084040 R|0|0| Rt 0x000)ڶ 0 00 0 00 0 000@蛶00 0@ccP@-pl04@Q h0S`0S  \0S 4Q h R`0S -tp04\ \ `0S0S t \0S `0S h h0R4\ -E-RUB €00)  B  Q000) Q/ `pG0娠0ApT   P 01K`@0bV0VP  Qros6p@-BT "00)  B Q000)Q  必q70@-P•0@0)\ "00)  B Q000)Q R7e000)0A-`r|W \P2@W\02WD0,1堂01,V0LFPm@A-\PB2`4@T p0S "0L0d2P " Pp   4@Tt@``0S h h0RP ` 4 R `0S0SQ ` y` uL0S "2R2S X1 0 0 <0 R0L0L00)=0px0|p0p 000t x0S0|@t0x@ RLi`P`0U$ h h0R 00)P  4 R `0S0SQ  ! 00)x@T00)l R  GM|p\1\A  R @"\0S0.000  00C0|B T 2T02T0,1 0"1 W0LRUI ‡00)  B  Q000) Q6 `G0mmhFPm@0AT   P 01QJ`@0bV0V P t QΎˎ14BT "00)  B Q000)Q  5—0@0)\ "00)  B Q000)Q 5000)000 H 0S P 00)  B 000) 000D0S P 00)  B 000)D 000-pЍ -G-! `p M0 000) R  000)00, x@T X\0S` `0x ` 0hRL00S0YS S0S* SH0S 0 W  PP0V0U0S 0   03QH0400PUHP\Po 0 00 0 00W  P00,P0V0U0S 0   03QH00PUCp t0\PR+ 00)4 808084040 R|0|0| Rt 0x0p0t0480808 4@8@t 0|0x0S0|@t0x@  )_6@TTQ P0\ESG@  P00) 0 S  0 S000)  Ѝ0-40 Q', 0(\Y,0   11@"`QP0@-P P P , 0@000S p0 bP00C0 <0@<0@00m@Rp@- P@QM `PP, 0 03Q l\ PЍp@-@ Q q 000@RA-`@ptqPW P4V V +V! (@000l`p60U0C0P嬀 ul0Q UPP<0P崀 UPP<0P尀m@R0@-P@Q M <0 0 0 3R   003S  m^ "k PT  T00P0S, 0 03Q l\  Ѝ00@-P@@M @nk00) < 0" 200 2 B 0"00)wC, 0@ 03Q k\ @RQcc@Ѝ00p 0-0e-H0P <0 0003S^  p-, X14 0<0Q 0  003S ^  )H0HH@8 88@ 00 00) p(RQRRp@-P@PM `, 0 03Q Ok\ U , 0 03Q ;k\ (eЍp0@-, X14 0<0\0Q h h000S P00 00)80 2c! 00)P s04e(epp@-P`PM , 0  03Q k\U @ , 0 03Q k\ VUЍpG-0S , X14 0<0Q l3R  X3 T0S  ,0#0H #&R*40!0 0 m,0ꐆPmoo-0V *JJP 0 T :000 0"Q: T0S  0b T0ЍG-<0MP):  1 0A  P* 0 PES TV 0i0S6#0%6 pR`a@T 00 8!$00C0TᎺD04  )?0;1P P= pdf0eZ#V 0@l  8T X' >0D #&R*00!0 +Pmmnloo,jp V:%Z0ZU:PU 6#  Y * PPx0 0PmЍG-$M   P 00 c B  \* PEQ  0  TV 0c0S6#  e0 %6 pRa@T 00 p!$00C0T չD 014  p?0;1P PK pdf 0eY#VPP @80(&R*0!0 0`8T X_ >0#Ơ \*(0 !0*Pmmool",jp V: ZZU:PU 6#:: 00 0\0* PSa 0 0Pm$Ѝ-0S *08PmE-p!F1P T:!01 R h 2%* 0!`D'  %6RQ@T 00 $00C0TPD0Q4  ᡷP?0;1QU Q T@(8,&oІomPm,G-`PpM0@& Z?= ;>0"#Ơ\*000 1100S S, 0( )P$)L@ 2aR!"! 8 2R!"! 0XC &?XH 0 T00T00 YW *V@` ((L@ 2R!"! 08 2R!"! 0%ooPmn X K&XЍ0@-@$: 1P\7   040?0;1$%/P" <0"^!l0"! J$J>0QH @1#Q :#: S cW0(0茇PmoG-@MtPL t,0`pdS:\P2V  k2V/ 0)Pm cR$*@0b~p:#:S >0N@\P2V  @2V 0 ZЍE-@`M( pQ $\$0 00_'0\ >0(/ ,0a 0PS y%Pmt%6 1!Qڴ1 PT00T0 (@ (8 oPmЍ@-SP`0p  @ T%@P FV! T0@0T0 $0 (nPmE-P`pM( Q \ 021t   @P t#000T ,0 T (W0 Pm< 6 1!Qڴ1  noЍG-p M00(* 0!`1  (6R|Q@T 00`!$00C0T ᙶPD1 Q4  3P?0;1 QUC@T 0 Pi7  0/@l8l` 2R!"! 00S   0{mPm8 2R!"! 0 ЍA-PL@px`1U0 * 0fPZU:@-0 pRppp 0h@  `X0XP0FH 5@Prqqq poqQE-L@MR0 )  R C)AvUK, Z4:<0< <p0X* Z` P# #x! r 0lS@Pj 0V@@T`h&P 0 0 0C@P<< 0) )A:UKЍG-p M,`P0<00堂 0S 0S >0~pW WU1gZR000CSM:0SW`0  \0&R4:1 sR.V2 0 S S) 5  1 0   1 h0S 0@0@ 2?0:: SufP 10 S :#:S  P BPP V000 <   1p01 1 !110p01  1p0A ( 000 4 ,0@9PhX0&Rd:1 sR^1 0S 'PT V" 1@  0 0S  F@0C0 0T 0  0S0`000ᴑG X0'&0X0 \00\0^to2X\0 0  C.2X 0 0 mPmt Ѝ0@-@PU0, TP001N@eQ:P  0S0@ A-pQZ`8PQQP@A0S0\S 1S P0101500  Q*0S0\S 1S Q010100  AU00!0S 1pGW0@-M @0\ 0\2" 0@\0SN0@D0 0PS   0@S00  0000hЍ0P* \ 0S0S!0S \ 0S \ 0S 0  R 0S0S\ p@-`P; 0S   P 0S p@ 0P  R 0S@0 PST 0S PP0SU 0S0S Pp00p踇@-P"FpX`dX  \00d\00 VQ(0S 0S 0P 4 1QL@`3VL@,0 f0,0) @ 00  11( ( 0, 0c , 0 p0 40R40 000(0S 0S L@`|t0@-3C?6CQ@P  \ 0S0R ! T 0S Q1:R !0S."*R a0G-` :#:Y  SXM1iV>0n`V L@r PP@  00R: R*0 S0S8@P s 0 S `` U t 00 0S mPU 0 S:PZI 0  `Y @!@1V`!(0dS 0S  0 R 1  0  R$0$0$ 0000C00"W0   2Wh0 00 PZ0S 0  0 &00PmtЍ0@-L@2 0P )Q\QC)A~QK7 20) )AwQK00@-PM@00T   R 0^2" R01000@d @TЍ0A-P@0000T0X0\0T9 (0 ` pGS 0S  (00S 00C00 R 1  0  R$0$0$ 00 0P Y280b@XQ 0+ALtp@-`M PR0@S1 0S-0 @R( 0S$@ 000\*0 0 R  P0S @@ 0R 0 0P00S00S?0 R 1   00C0t0S 0 t 0$0t0tP$0ЍpA-`M m@Pm 0SPP @Tb 0S^*000 pPR4 40RN( (0RJ1QF 0RBP  ,00, 0lS80S 00 (\ 0S  0C,  , 00C00 R 1  0  R$0$0$ 000P ~140@P@W 0S:00tЍ@-8@ :XM@@H0P<Ot 0:@@ 0PB0t@pr|Ѝ@-Pxx@P" p`0@H00CH0 R 00 R 0S  00 00C0pP p@-`pxxP^@ Q#:0 H00CH0 R 00 R 0S  00 0  B Pa Q*X0  b0248!!&A aO 0(^ poPm -R 0S  0  d00C0x H0R0CH00x0 R00 R00r pG-t1tt 0 2p 1A(@L0 00S:00 1@`V?PO08 3 pG P P* P$$0S 0 C611Q78P 0S X0X 0 11\|Woo0poqq pG-p Z%ZjeV`! :#:,6 *2 0A@T 0 S 0 S  )000   )mNT 0  b0248!!&!PU 0  LpfjP Wtro-MЍG-~p0R`P\ ,0WY*'6&2`!` 01PPU 0S 0S00)   000) N@U2 0@00)   000)    pH00H0`x0S0@h0x@  Q 0 0 @ d00@tro pE-l`PM `00) R  000)p00 R 0 0)@000)T 0  @T00 000)0 S  0S000)ЍG-`M 08 ##<!R 0 , Q400S*,0(4   0 0 S0(0a>0( 0aR(050S (0 S:3(05(0S(P ,6"*2 01p@@T 0 S 0 S  )000   )MPT 0 08 !#<!R010,0N@ 00SP*0S(*,0@T(5X0*400 0,04  R ( T030#Q0S P 0 0S :,0JDT2#X 4 0pW*z W:W, Y0S 0 0)@000)T 0  @T(:,004 Q00(0 004 ( rt R (0 S:(00 0q 0, ʠ,ʠJl2 aT 1a02480 @  Tm  0SehX5P] 0 0]  @1P  )000   )0000 H00H0x0S0P0xP  Q 0 00P pS (0 S:(0d000P d000P 0 ,0 | 0  0\o p,0 Q: 0@X0$0  jЍp@-P`R@1@! 8LP @` 0 00d0 0 0 0p0@- P<0M @0 003S\ ,0 @ % 0^XЍ0E-p@0 R !L0`P)PaPUPaC)AKK P 2 02? 0<0 P" U  "/L0 )  )AKK\ 0 l 00G-`$MP, 0Q057X 000 1 0PQ d0S 00S 0h 0R 0@0@ 2?0:: S0 -]PPUmP"0pQ05q7Wc 000_ 1Z 0PSV 0SS 0QO 0h 0R 0@0@ 2?0:: S0 \PPU3Z1 0  PV  0  003S 00QO h0p =P 0UPV 0  03Q 00Q,O,D$ЍG-M00 0 0c,0,p W:1 <0"Q  ('F00Sß P01`@`V 0S 0S00)   000)bJV8 Z00Q0S =P 0 2 0S b0248!!&A Z  2( *Ht2( T2 0 7aaB  j@TZ Z  00 0A@T 0S 0S00)   000)I`T P1`00)   000)    pH00H0x0S0`0x`  Q 0 0 ` d00PS0` d00P 0 0OZ o troPmq p ЍE-pM0`P  @\R 0U00 GL 0)0!0S0!C) AIKZ 2: S,0UP!U@3:Pg, @ 2 02?  0U<0 @" T  "/@ 0)0!00!) AIK*Ѝ-40  b0248!!&! 0oG-PDM4 %@  <08 A, 2 \80@a3 8 U*`%::DF8 00( 0e0S6#V,00(0 ,0Qd$ F`@ ` Fl @ VP24?0;1$%/0$P#F 0$ <0`@ ` 0$ 0$ 0QpP8@z @x aA( 2R!"!  8 2R!"! 0!(61  )000  )7UA  2@R!"!  8 2R!"! 0@>0a#<0 "S  R Pmo  ,0a0@ 0 Y p:( 0 ` #J,J( T0:40@0!Z8 Z40U: 2R8 @0c0 04PmDЍ00@-@1 (0(S,0P:#:S 0d0PS 80S h0 , Bh0S 2: S 0d0S 00S0f(P04p\p0@-@0PP/ (0S, \)  a0 P  0\ @L@ 0)0!0S0!C)AGK k* 0)0!00!)AGK00G-P`p㠢 @ )A\AC)AGK:#:S->0n``'*0%pV" g@ pT 0U1P1 V U* 0pP  p0pPP @20 )  )AGKG-,M$ ( 00d 0<00Rp H0S(LP L(  0 : 0,  0S: ]@n Q R @ R 0  :0#:~pjcV`!0'6*2 01PPU 0 S 0S  )000   )F@U; R P} ~tr04!@  )000  )0000 pH00H0 x0S0@1x@  Q 0 0P@ 0P FX $ b0248!!&0!\  0 0 3R  G`` V (d 000HD㚵Y  $0 i 0  $0 ^E 0@, Q,0S ^ o p,ЍG-p:#:`'6&201PPU 0S 0S00)   000)E@U6YM PH E 1@00)   000)    pH00H0`x0S0@0 x@ Q 0 0@ Q hD0P T>E40  b0248!!& tro p 0@-`0  A0P@Q 0CԴ0@oLpG-0 n$M  0h0`0CB022PDP0;0 l:\2PL   00)2 ŸR     )0S00)  0 S  0 S000)!0S lP0S0\1 ` pL0 )  R C)A_EK  0@"* R,0^!^:` @0 02 02? 0  @2 0T0 02?L0 )  )A5EK{& ( $ 0Stꐉ,p(p$p(p$Ѝ @-@:SpP`*@P:4# A0 0 000P@TZ 0H:4#5P(&00 kDtrr̉E-p1#61 00)  000)t@tPt` P , 00屲 P  p 00E蚳o(p,pG-P<0MP %: a|@  P@* 0epWv#V0(`Q&   04Pm(/ +! 5?PDF `Vf#  0 `08JPT:) `P:` ZZ U:  0 0PmЍG-PMY 0!X0 10"0Z0`0|1 @PM  ,0 a0,00 崑0Z/1 @P/ 0, 0c , 崑0 0R0 000(0S 0S <0`UD` @P `M pP `' Cot ,0 a0,0 ,0 a0,00 崑0R0 000(0S 0S (0L@`V ЍG-p`:#:S >0*X p6  p1L@"0)QC )AOCK pP 0ST 0S p100#"PU*  @pP  20 )  )A$CKG-PY0X 0Z`㴑2@PK  ,0 a0,00 崑0Z-42@P- 0, 0c , 崑0 R 000(0S 0S <0`Q|a@P `IpP ` ? ,0 a0,0 ,0 a0,00 崑R 000(0S 0S (0L@`tqV  0h#6 \ 00B\0tG-R , X19 0<0P>0pW*L@P 0S  `T 0S ` Z1P:*0U*  @`P  wA-p`B 0P ) Q R QC)AAK 000`p!\0 @ r&"Q`0 Q 20 )  )AAKop@-L@2 0`P)PaPUPaC)AAK\\0   Y 20) )AAKp@-, pX1P9 0 <0 R2 *` @` @T  ʌ: 0_`P !@-p, BP0)QC )A_AKU` 0! p rX0"ST0X Rp20 )  )AGAKo@-L@20 )  R C)A+AK 20) )A$AKE-P` :1 p@\  p :d14 ?0;1 %/QZF ': `. '6pPP@T 00 $00C0T>D04  ؟?0;1PU X ,@88P蘊PmmE-p@`P, 2V0 2V0 0W JD mPT2V d0  YJT: ~2V0 0PmG-`PMr0 @ )A\AC)AJ@K :#:S>0.  P`X:f P pP 0 S00jX1  P h2\ p6S P pʠ2X h&R 0 S0 h TPy 00jXX0 1R00jS: hX0"Ơ 0X0!  "\0 0\0 PU0Q ,APPK @PB  0&P;0@000, Q 0c ,  000(0S 0S  _2X & X   "\00\0PtH0 P20 )  )A?KtЍG-P%: ! A M a UM* 0eX#PV0(:*`Q/  剽 4%/ +! 5?`TV pWv#U*D0@8ZT   bFPm) `P: `0"ZZU: ,Pm ЍG-*:(!(A M 10 Z*0 S  0ftv0jY# W\*'6 PR0@`T 00 t0$00C0TxD4 !4  0'FPmm?0;1P PDF 0g`Vf#T*0S C P 08JPT:0S6#zz W:0S 0SP  4 ` R *:2S 04 R0S * 0S. PZh:0,0Pm m Ѝ0@-@HP00 P05 Q  0S :dƌ0 P P Q  0S*:  0opP@- :#:S X@] 00@4 @T 0S @T IXp|0@-^PU H0 U0P @P 0oA-q0@1@a"PU1  0:CQp'* Q*`T# 0  003S`@D Q: :cl`T 0 03\00@D^ PUhp@-pJtt0t`P,0#PPC @D0E0-J<0 @bB Q<@@@ 000qopA-P  :MPPl0P `က@p ``:]P U0P0#100 ' Q妹딌qppqЍE-`p40ܠS P@ 40 @0R@PU0Q0 P,0 C`1#61@D tQ ;(P@Dt, 0 0|oZP L@TTH @L0L0L 0)0!00!)A;K mO0q Ѝ0@-@P00 0S H0t!0)00S0C)A;KHL0S L0S,0TL00L0S0)000)A;K0)000)A;K00) RP00  )   ) 0S 0S\P00)0ȍmm0qq G-@C=?0SM LIDH Io 000 0S 0S @ H@^ R00 000)@Y0I@0<0@080 0 $0 00 0) P,0 0 ` 0V0R0S , 020Cs! 0@2"&!! 00 0 0( 0Cs0 000V  P 1p 0S#10pWr 0  00k 0S 0000 PPU  , 02! 0(1"&!A pY: 0(@0CS 00@ἑ0 `PB00S  0 @R@@10PEu`00)h  00pp0 Sp D B 00 0).4mmhoq+/å0 0, 0B@Dt1l #61Q 48(P@Dt,00)  B 00 0)qoЍ0Q H e꼎-R0H0   X꼎Ď@-p@Pv 0P0)1 RJ 00 0 R  0S0c000)0c C1# 0000`P 0   0 0  P 0 00 0 00\0\`000)uP 00)00) R  0t000)k+/å@-`PUVv 0p0) E0@ 1RU R2 0 B 00S 0S 000) 0S 0S  00 00@@ 0 R   0 0 @ @@000) @1#6 1!@`E0 R 000)lh0R\ L 000) $ @+/åo0Z"0#&10R*h2! PB8<0"Q!"! 05 0 0 0 0 `A8`T00CT0 2R!"! 0 <0" aQ!"!  8 <0"Q!0"! (0S' 0S$  0|@\`8 2R!"! 00T  BT (  P/  㟞*ooPm`Py T00CT00 @ 8 2R!"! 0 ,5 0 kPm ЍG-M0 T   2\ ,*! J* `&": : Z!Q)  Z04hPm&%/P6#::Z p1p! 2Jl@0 00PP\:P6#jj V:P  0"ʠ ʠ 0 0\:Ѝ@-`2plP@P 0UP1P 0P @T2 h l @- 0pLAP@@T(` 4 R P1 T0S \h02h0Sࠁ4 R\P\ P @TZc G-`0VP PDPU& *P PU !|P @pHP @TLWPU PZn ≲ 訐0@-HP: 4@P $4P @d@  0@pԐA-L@n0 h0`0尀p`M20 "";0P 0R00R*0P 0P S0S <00 0R:rqq0- g0G-HM0003! ^:Q3 01Q#q ,墤Z:t= R 0 R L3LH\-0,'0  0W  3PK L@ @00) R  000)`0S 0 0)@000)T P0  @PT00 d3P00)0 S  0S000) 0 S 匱0S61!p00p0x!t00t000)   000) R@ ʠ (p(phPB Pd08 RD0S A`p(@d0DPI `| W:, Ip`h (0 0cC @>QP2 0`p W:RP1qqqr,HȑqZt0  2PLHӡ00)  B 000);8Hq Rq200)0  000)0  ^2[2 0 00004\ 0 {0SʰqxHЍ-p0 !\:\仰0P 1!,P:8䰰[2P 媰jqrԒHq-!l"&!!\ L0\ D塮04䊰 0S 䄰0VotE-1#61 pA P 1 #2P Ea`V E[ p 00)   000)  000)  B 000)` E/o@tt-!T"&! 00%0  0oԓE-0p`00)  B Q000)QO 0 0 0g$0 00 b0248!QQ0 2@5r00)P 00f0 f`p %P 0!0C 00!@ v _1P11 @  000)oq-(0 P(0 ooG- ZpM\P0@ M88 0RG((ß 00bdsZ00Bc0S 0;0B0P;0-0 1R(*,0;0  )000   )%00)  B 000) + 0QP  0 0)  "= p1@`T2 00@  b0248!8, 0 0C 0*B W WpGP804`` 00 0,1a W 000)<p@ W p1@`T= 00@  b0248!8, 0 0C 0*B W WpGP804`` 00 0,1a W 000)qq@Rqrqop@ W 000)ЍG-M00)@p尐ឮ @嘮`W0P1BŠ 0@P`c& UL~pW00 0) q,Hqhl`p|ЍG-`1Y U PUP U\# 1#61A`V p000P0 `/ (@D 0T0P1rጀ  0刀00 00C A0@T0 ` ~/`P U 0SqoA-D 0 q 41Aa,0T*| |0P* 00S  S !0P  P @`VrqqqA-@p`PPP0S UC @1`0248k6U T00T0a0248  0S  00 0@ 0D@0 @DT00S 1D 80 8oPm-,,0, M 0 0jꈔqqqqЍ@-@ h!P000/`P H1H  b0248!!&!HpW 0a0248600)   000):#: %6 P ,20 R  0 0@ x H0R0H0 @x@qot prtp@-`P) .1 %0 Q#*0 1Q,4S* @ R 0Q00 t0  Q \ Ѭ 90`p84Ƭ( qrq4dЕ@-@P ,1 0 Q*0p 11,$R *  0S @8嚬0, ᔬ  Ꮼqr T0@-@ 0Q00 P 0a0248qd0Q P0Ta0248` ,0@4qot0@-x0  Q 0 00  @0D @ @DT00S0@oA-Pa!0q00:#:%6&2 0A@T 0S 0S  )000   )-T0S0 0T 000(tqtrqDA-`PP& `P 6pP 1p #61A`PaP :- 0oG-2MPU!0S| ࡟ !! 0 0S[ 0S 0Pp `@@0S0 "# P < 0\# 0 @Q  00 0  0\0C00L0 0 0@0C 00\0S 40 !00QU !$$1P 00P 0PQU !$$1P   PqqrUЍ0@-PP@ %1 <0 Q,*011 ' $0$ 1!P00,0Q* @ R 0P0B(00Q50QP 0000@0@80@00@(ߪ0qrqqlؗG- M 0\s*@ 0lX#ƌ0`& QR  峪04H/ +! 5?PDF `Vf#0Pq'61 0Q/  >01S'8"(Pm Q08Y0   )000  ) T00T0JPT:0 @# P: ʠ ʠ\o: Ѝ@-p`PP @0U @T   0!0j @TFG-h!M0110, QU* 0S S Q:I4 :PP 0 R ;0  b0248!!&q@04@`T  4@ T0 l0  R @0#R 8  0(  ro `qЍE-P`XM, X1 0<0Q %,`pv1P$011P 2: S 2R 010 P 011 P R0S S`P}\00000 1!0P0000C`P9 РQ01$$!P 0@01Q01!P\0  j2b2c621b1c!B! 0 j2b2c621b1c!B!!003qrs0S @X*01p> P 0S $0S  0$@pH@@( 00b0 @` @@@@qXЍG- Mh`P Er 0!p0@W7*  04+ *C 00@S0@Pp4p,0($pU * 00S  SP\:!1pt0@( p0 `W:ꈘq̘ ЍG-`*lM  , X1 0<0 Q @X)p3S p4PW*0W0W0"0% 000 0000 00C , )00  88"00C0$0 *`v@d` 2`: S." s02@Y `PPh`8> \"#<!R 0!R5 `0P"*$P 0R( 4 P: S!`0P*P 0S  0R 4 P:wP ` 00N@ \00B-P@ @ ;-P4@T T7  G)!03  0S,  P,P q ,0P^*0!3 0 0,0P:JQ 4`㳧qrq#rrؘ H40C0<2,$`R(2PPP ` ,0 ` (4V*̊Q4Q:` 04P:$V c,0 B 010d^l`h] 90P `S R (000(0$ 00K0`P01 $$!Q 00@01P01!Q\0  n2b2c621b1c!B! L 0 b2b2c621b1c!B!!`(}tqqr 0S $ R 0P P >0S000 000$ 000Z 6qlЍE- 0  0$0^+*Ȁ,p011@ P R0\*`01 0S  S$00$0 00 001!\: ^:$0 6&$0 qrrp@-`(@tP0h@P 0S 0S @ @>p0@-P<02 @P05A7T 000 0PS P hPEP 0S 0S @ Py 0@-`Q MP+L@ 0)0!0S0!C)A(K H0 `0GpP d0S <0S  0)0!00!)A'K ЍE-M(@tOP2 @: SG &@PBh0@S 0;0@ 7&@P3,0hS 1 !0h#LQ`p 0@0@ 2?0:: S0 i9@@T h0S 0S  v@& _=ЍE-M@<02 `P05a7V> 000: p@W4 Q1 " @D: S+ 1( @ $,0hS 1 !0h#NP@P 0@@ ?0:: S0 @ 9@@T$@Ѝp@-P M'@t`Ch0@S 09Up00% <0 0 3R @P  0 0 3R00 @0T0=0 B?"P %@P F@< Ѝpp@-P0M'@t`/h0@S 0%Up00 @, 0 03Q  '\0 - 0$ %@PdF@<0ЍpG-P`0V.<0.岐@B ᱠ X0`1X1 3'PupQ%PP  0h0S 0PPO<B?.㳠ᲐX 0@-'@Pt2@: S +%@P<0"  PP-<0@-p\P"0`P05a7V 000 @pT P 2pG: S %pP"0 00" @<0@-&@Pt2@: S$@P, X1@7 0<0Q 2 @PP;00@-!@ MP<02 P05Q7U% 000! @P  R h0@DS 00@  8#Q:#:"A *00E@, Ѝ0p@-!X Mh&@t` h0@S 00@ 8#UR:#: "A*00YE@x; Ѝp0@-!("(P M@\ ԣLh0@S 0E0@ A8#QR" F  2  : S ; 0  0S : S 0 ;8#8 0 h0S 0S 0h B0 긙 D@ Ѝ0@-!x("h%@Pt @;@-!x("h%@Pt @:0@-P!("Ƞ@<02 P05A7T 000 PP aP^0A-`pP@P?  R 0! P%`vp-1P $`P!0 p $ d0S0 0 0S 0S `P 0= 01 #00:)@-<0pR2 `"1@T*2 TE0TD`P  0 000000 0!R ᾢ 01`ԙ@-P`#@tp@P  iPu <0"Q20 00" 0T @5@ -Ap@-@` 0PS $0S !00 Z#p@:@-@pP`U\c 0PS 0S P0S Q5l@-\PB0p\05 q7W 0" 12  0`00" 0\ 5 000-, X13 0<0QP A@-@20 00" 0T @5p@-`PS S 0 ,Po P`V 0 U0V ` 0 $ P p0R0@-P<02 @P05A7T 000 0S 0S P^ / 04S 0S0 P0؈A-M `@|p"0PP05Q7U4 0000 0S+ 0S( @X% @0 P 0S0  0@S 0 0 3R L#\ @@؈ЍA-pMP<02 @P05A7T4 0000 1+ 00h `R 0@0@ 2?0:: S0 4PPU  0PS \  0 P8ЍE-M`<02 PP05Q7UL 000H 1C 0@0h R 0@0@ 2?0:: S0 n4``V$ 0`S \ L@ 0)0!0S0!C)A"K  0 ` 0)0!00!)A"KЍG-P`SLM z `F XwXA `ZPn `, 0 03Q  V#\W pW* 0 Qp:WO0Q@0h `R 0@0@ 2?0:: S0 3``V' R   0p`V` 0`S pQp` PX PH 0 P`P 0Y |LЍ0@-P<02 @P05A7T 000 0S 0S 1  0XP,0p@-P`<02 @P05A7T0 000, 0S' 0S$ 1!  0L0 )  R C)A!K 0% 0`L0 )  )A!KpMA-pM 0`<02 @P05A7T8 0004 1/ 0h0S 0@0@ 2?0:: S 0$ p!3``V 0`S PU 0S 0`ЍAЍMA-pM 0`<02 @P05A7TT 000P 1K 0h0S 0@0@ 2?0:: S 0$ p2``V- 0`S) PU& 0S" 0L0 )  R C)A K 0 0`L0 )  )A K4ЍAЍA-`Pp嘀&@0 R x 0 &@PU\&@P0 R , 0 &@PUry,4A-PUpM,*0ES =Pa Ua 0 R @ s&H0 Ѝ-0M0 0 yHЍ-0M0 0 rXЍP@-@ !0S PPD0  R R @0@rP@-@ !0S PPD0  R R @0@yPp@-@PA`0Sp"0P00pprPp@-@PA`0Sp"0P00ppy ,R0@- Hʔ0QU000S P bTP b;P 440S 0yhp@-`@P 3P  0@S @p@-@  P $0S p@-P@`* P  0PS Pp@-(8",#8@b%0@-8("(#<,@,M  \ N%PyĚԚЍ@-8("(#<,@,M  \ 6%prԚЍ(0S0 000 - X:$M  0PrЍp@-<1  R&,1@ R00 00C0X  000P0B? 0D H 0S0@@pR <0A/Q |P|`0S l0@P 000H@@0Q400p 0R<p@-`PX@U00B?AP 0D H d0 0Spp0@-@0PS  0T PR00 000@OP0-00CS0 R00 00>E-Pl`M 0 `0 000)0 R,  0000)p00 R 0 0)@000)T 0  @T00 000)0 S  0S000)  B ЍG-p h0đM0QL 1 P0PESE(0S@V  0S/0 XW( W  000 X 00 0 0 , } 00C 0  B 0PES@(0S0@SQ. d0 P0PES!(0S@V  0S 0 XW 4p0PES@(0S0@SZW XzЍ@-H$H 8M@`@-H$HZ 7M@O-0@-Pg8h@0S T 0S 0S 0@3p@-`<02 PP05Q7U- 000) Q$ @T! 0`S (\ L@ 0)0!0S0!C)ABK ` 0)0!00!)A<Kpp@-`<02 PP05Q7U- 000) Q$ @T! 0`S (\ L@ 0)0!0S0!C)AK ` 0)0!00!)AKFp-h1 R!\!80Q4  R<'8 0S( R0  08 8 Q0 00800(041 \ B R 0400 4 B 8\ Q| T0Rh 8080(P0S00(0 R00 |ě\|pp@-@P \0  Q<`000S@8@008 8 8@08@p |@-@1 R媘( 0S@8@\ 垘008 8 8@08@( 4!0Q00 06@ @"."># @0# "XX00  R 4@4 @0400ԛphdl0@-P|0 H6A A" "0# A1# "PP0 P 0S0S0S0hdl -P 00 0( <! R 0PG- p0!@T 0PUڼ0`S0 ; 0SZ0/Y@PEUpWpG- <Qp aM Rh P (0S85  00{0S @`FVYtЍ@-@P9, 0@00[- L(, @0D@-@0@ G-@ xM  PP 00,040dQU/ 80\ Q9 0R 30S-Q0 08 8 Q00 `0@8@@@@b  P |ěЍ00 <0Q 00 $0 0, R R,0@Răp@-@0 Rp@ј0PPP(0U (P Uh`h0\\P2/0"bS0#4S 0SypăQ@-@$0< 1#61  0S 0C 0@臘oМ 0-S0 @- M+ 0 0 0@P ЍG-@pHMhP TS*WQ  d0  ⡄F  d 02S`0 "<!@R(UP1UP# '0`@T *  0 P {VF p@TPP m@T0 G0@P ]HЍ0@-\P0@#SHH 00C00@HD$0  @0踃p@-` 0@TP @T0S@0C 0 p|0j@P H\ 000pV 4P @0 0C 0pp蜃G-p, 0M  0@ZwJ` P @ @`` `p(`0PU$0Z`T @}TT8Z S @8a0FS 0 0)@000)T P0  @PT00) R  000) 0 0 @T @@T0S100)0 S  0S000) 0 ꠃЍA-@h0և$0!1#61q X PX0{PP00)  B 0S@Q `0S 0 0S00 0@墇000)㘇~P 00)  B 000)mP fP A000) A論婖oq@G-p("(8M@ 0 XH夔A>,2  `0248P+; `<0 0 1P@@  @\ U00R0S Z6 $ 2 $P/ 0 W 0 W0$$ $0$$ @P8(0S IP  00C 0 W 0a  0`V R  \Fxod@r㸆PP00) 0S 0 0S00 0墆000)P 00)  B 000)sP lP  000꜃q8Ѝ0@-PQ @"0 @TT$0( 1#610@D0oE-(M p`00)   000)@h0  0R1BPEd0@8Uh" 000(Ѝ@-`;; V  S@@T LPP2  @PpP0 `^  8 0880000 S!&<@A0!1$@ * 蜝 |oE-$`P 0PS0F U``p@0P0C0U4㬅 0$ :C0G-0MAԔ0Д0̔0Ȕ @`P1pQ ᐀0 P@`R@ 0QP0 P `<0ប R ԝ p08ЍG-@ 0S쐟젟p쀟`M*@P:4#Q E0 0 000P@TZ :4l#5`PXl H <:P \dhlE0000SP 0 pЍ@-40, @R T D<@G-MH0`ll!p0S0E P0P2V0$(V0 p0 1,  aR 00 0 , 6 00C 0  B @0PES (0S0@Sē`V0S 0 0)@000)T P0  @PT0S 0 0)@000)T P0  @PT@RЍ@-@, X16 0<0\' PC!@0@^  0  03\P0 ! @ < 0Q,0 Q0@@ă G-L@n0 Mh0`02@@匒"0S 0`ql0S0N P7V0I/V0A'0$"  0 0 0"$ 0R,0 0  _0 00H T0  B A @0PESd1 X (0 S<0@S0ݒ `VX0 RS000S 0 0)@0000)T P0  @PTuX x d0 h 10aSh00)z00)0F],DH1pă@Q< Ѝp@-\Pn@L h@`@l024`82P @@00lU4ăp-p0  RX0P 0S R 0S L RhpA-@PPp`P@ PU@00 00$0  @t PP PtW o@t PP P`0 0S$0`` 0L``hl@-0 S& 0S@L  L R 0SL@T L0HL0 0S4 0T00Phlp0@-PP0 0S 0@@0S 0hP 0 @RP0dD0S P 0 0  0 Sdp@-PuppD0@`T 7P @`Tpd0@-0@PTP P @00STT06 0 0 3R ;\ 0d 00S 0Sd-0P P P  G-P2MpX} Aa0 0 @@0PS 0 P0S0 PL0D`  R \P  R DP0KS $"P0AS "P 0R 2"P 0S "zP@0崠S  0 =P0S$ cPd_LPXU:hQtğПܟp  (Ѝp@-P0P@`T 044 40 4 @PTU:pd<80p@-|0PP`@p @T PT P @ @T  Ppdp@-0@M 000)0 R,  0000) P`00 R 300)0 S  0S000) Ѝpp@-0 X@`T$ 0S U S0S 0S  R 0S U U0S 0S @Tp\0@- X0T0@ T 0S 0S 0S0@T0\0@-@PTM P6 0 @DR1 , @ 2 02?@ <0 @" T  "/@@ 0, @0D 0 03Q {\@ @TЍ0p@-0@`T 0S0S# ၏@T|P|0 Q)@P 000<0  0 0@0@p\DTXE-` X& *]@PpPh D@P ` 0P `$1P P`p@h0@-@0PP 0@T0@- H $PP 0@-,@0 S 00PUR,P @ &&00S 0ĠA-p X`@PR ,0SO Hᝰ 0(0S T'0 UX  0p $ppP)0S  R 0S 0S K 00R 0S +P ,呎0000OuA-H- p$X`P/ p$<SR(@ 0)0!0S0!C)A7K pP X0 U y@ 0)0!00!)A%K-Hup@-, X1`6 0<0Q( @t!@2R: S h0S 00 @h@Q ,0 \@P%T@p- - P ,P 0S0S  "G- PPpM$ h* \ JPIDPu@B 0)00S0C )AK 2P: S"0PSPE (0cpP P P P  h P T 000, P:%0 0)0!00!)ApKHЍ0@-@PM*00S P %0 0-P 0S 0S   P 40 . 0 P 0 0_ Ѝ0A-p@t`0hP@U ,0@DV %x  @$E-PP|p PPᢻ P 0U:1  0x @eT@!v`P 0 0 3R \ ` N -<0 RBG-`PplM`` , X1 0<0Q~ <0"0S PPt  lPk@PPfBPX^ @X 03 PuP`2P: SHh0PS 0A0>BP$P9 PEP 4 0S  02 0PP"PN H '88  S0pp1PP0  fPcU # 0S $0S . lЍG-`㸂"\M0p#4A`PP5 @"0$1 P# ^P, `PR 0002 ,Q 0002" 00 0000S<0@XM s*0`20 0 P001@t00001@:+T  ΋7l`1PU/ 0)  000C_@P ,0Q 0 0002, R 0002 `  HH QPT婉 PU04堉dGu8D8Htd,\ЍG-P H<0|a"尠 pfP`m@'""#0_  Pu@0S"@@T0S "@T 2: S "@T 9  NPP|1 d) (TH P8 (uP|ȢТG-#M($ ,    0bP+3,$;0 Q 0 !R+ P @ UE @PU `3 1S  1 OŠ# Q10$\ Z*  0c X !jpPY 0[ XV S,$00qS (2 P@n'0@0Pn S @L@T@@T@U ;P UPEP QPU PUP PU0 0W  R 0 $0 0h$$/ 0 , 0( 03Q  (00(0| P4(0S E, 0  00 q#'W p@Y 0 eP0pA0 E0P YP U R0 Y  0@ FP Upa0 $000P0 8P U0 ,\$0#ލG-M@K<\,(@80Q  0!R ( (0@$@8S` 0$S$2@0!@0R 0/5! V U  0 0 R0Sr!  0e0@ T @!T@N $ E4(00@Po`$  : (0@ pǏ0@`P$ (@ $0Qo` S xq0(AT Q* 0R 1 4@ 0 0 S R4Y P Q A 4  4 ( 0P 00D0P@ύ@ T@Z@TU D Wi0 @ R0SRP#'(, P`8 80@@e@ R $0,, 0< 03Q  P !<00<00PES <0 < @@<@0003Q0PES0 0@ \ ``QV 0S 0P 0 0PP `?V`P@ V\ PPV P `/V0`V@T @0$0ߍ-0p@-@P M0l`S n0C0I20102020202020,00 480  0  0 3R  \  Ѝp0@-@P@@M r 202020202021 ,04 \  (00?0#%R ~?4 S?04 S 0+0 @00, 0@ 03Q  \ @Ѝ0p@-`2 @tP0d0S L0S @@T`@Kpp@-` @tP0d0S L0S @@T}@-pp@-` @tP0d0S L0S @@T$@pp@-` @tP0d0S L0S @@TA@p@-Pp`<02 P05a7V 000 @0d0S L0S PPUPR@-Pp`<02 P05a7V 000 @0d0S L0S PPUP)0A-pR)c @tP!`d0@S (0S 0d0S L0S @@T('d0 (@n-2966\ P0S 0S 0Q  0S004 0P00 0SE-`pPd0S2 0S/ P$PE<@P& 0010  ` $ d0 0S PP <0"V A 000 UP ] @-PUp*<02 `U05a7V 000P 0S 0S 0S L0@@T 0S Pu Y@-@P <0  000 3R00\ S @TG-SM 0 Ѳ<0< Q 2 02?0  BS <0S 2 02?0  0  003SP 0 2 0\0 02? {<Q 2 0\0 02? 0Z03S r  `V00R0S 2 0\0 02?R O V f 7 Z0)v%ZQ@P  TA <0S 2 0\0 02?JeT@ 0 0 3R  4`dV0  BS l<0S 2 0\0 02? ЍE-`Pq1T 0RpQ00141 041@P >0 T 000C(0,00040R#!  0C"#6X0@`P0S "T00T0 z@T twG-PXM`dpP\ 0SY @  PQ 0SE \ @P 0 P8Q6 0@x0S , @ 2 02?  0<0 @" T  "/, 003Q   0 0$0S XЍE-|p2 PR @e~, @~@P 0`d0X`T`堂BEP0 )  )AJKC~W~ `堂Q~ PmA-, R0@S`,pP ` 0`0,=rVx`Pq2S 00)  B Q000)Q |A?!A?C22P d0PX00X0,0S n/ /S Q00Sn?0  KA?!R 0!R 1P X00X0202tlbP0p p@00T  P@0RU*0U:P R G-@M 1`r: S I h R 00 R :P 0SÊ AC?  ! P! "!0R!0S2/B1P `1  1S H1 R0111S0 1 1\` 10 R XY> h0S 00 0 t0X!  R 2 Rʤ2 Rʜ2 RY X10 0 <0 R X X1< 0 <0Qn R 0  00Ѝ0@-@ \0\!S1P 0P `Q 10X1ΠB? pE 0C 0C ("QH 00C("Q`10 X00X00n$1-S1!#&0 Q!"601 R$10C$1G-p1, PM 02 002?<00\0@T `0S  pP P :0 1X  X ,w 1S% @Tw 0 C 0C^SR0 C 0C^SR 0 C 0C^SR0 C 0C^SR  ' YPЍG-@0OM,`1R PuP 0A@QA A4A8A!P((>! P,,3phPP 1 , 08@  ( 0@PPU IPU P @^TOߍG-p` SP V 0  0S  ,0S0S ,P0VSB <0 R>s,0S 0S V0✐0& ,0S# , J`T@!T@0:#:`d d0, 0 0 3R  pV ,0S 00C0brX!G-pM SP0S  Ol W``L )   )ABKX0 )  R C )AS/K R0a 0)0!0S0!C)AK4| l  X00U R R <0 R 0 r,0:cS0SW0✐0% ,0js"   *"*JbT@!T@pd 0,0 0 0 3R W ,0js 0`0C0qW0 48 0)0!00!)AK )QC )AK 0QpЍ-DR  <0 0 3R,00T@-0@ Rt , PAA0R0Q-,\P0 0 0H0@-P0@ Rt ,0S 0A 000S0 0A0H0@-P0S@T@$q0- 00C0- 00C0-1 00C01 00C00000001 0001 0000@-@P' PP@F= 20l000XB?P , d02 :<08 4 0 0谆pG-PPB @P= `P8 P0 P* p P 000 0 00   00 1 2 Q2 Ap  8p@- P@ `P* Zt<0 R @1d SP1Z#<0 0  0 3R C0PS#@#@3@@PTPpp@-Pd0BS @0S p0 h0S 0 : S S SpR 0  p B?"`QDC ҆1P@00S X10 0 <0 R pU : S 0 X10 0 <0 R p 0S0000C00 .SQ Q 0.S<0"P0  R 0000@-P@P P0S 0S PPPq@0E-`pL@ 0)0!0S0!C)AKPP8 P@P d0PP IPL0 )  )A}K 0)0!00!)ApKP0S 0S  p@-`@\00S d0S ,0S \P1S01d0,@10C1p'`pE-` M0/SEV l`0/S T0S4 0S2Q 000x Pu Pup0S2Q 000 @t0S ppW{2ptV <0" P 000`0SX  ^ @ `># R/R P0R0c0 P /R 0RPP0S 0S PpP  pP pw,@T T 000W 0`v  P d0pS 0S  p\+pP 3 Ѝp@-`@tP -@t0S@pE-PJ$J   0S  <0“0  pw@#0g 0S b ` @T 000`L0)00S0C) AK T 0R` 0)0!00!) AK0S ```Pd0S 0S `h0S 0S  d0\`0L0 )  )AKVw@`Ts 2&`F: Sn ` Si v`Pd2: S S  S S h0 `S 0U0R\h0`S 0 G0`  10S?  = - `P7h0S 0@0@ 2?0:: S"``V h0S 0S A`V  h0S 0S lA-<0“8#x @tW PU 000`L0)QC )A-K U& 0R" 0SAQd0S 0S h0S 0S 0 d0 `QT 000`0L0 )  )AKp@-@("hP: S3  S , X16 0<0Q$ P: S S  S  S  S  S IAPu  f@8PusPpE-,@t] m@t`S PU 000pL0)QC )AK @U+ 0R' 0S5@Td0@S 0S h0S 0S KK<0“ d0 @0L0 )  )ATK 0@-@0PS 0 R 9P40!2   B?"R 2S 0 X10 0 <0 R00S 0  2: S 0T  0RP%d0S 0S0h0S 0S 0S u0S0  00d00@-W@tpe `v@Z0`ST PU 0000 000LL R *0 0)00S0C )AK 0)0!0S0!C)AK `U 0R K`0 L0L ) )AKS 0)000 )AzK642@p@-`@0PS 0 R /P)0 2   B?"R 2S0 X1 0 <0 0"S 0  2: SQd0S 0S h0S 0S d0pA-@t: Pu`/ @T 000pL0)QC )AK PT 0R }P0L0 )  )AK@TE-PN@t`H@tW @t`M PU 000pL0)QC )AK @U% 0R! 0S@DP@Td0@S 0S h0S 0S d0 @0L0 )  )AvK20 G-@MPuwPuPn  @tb @tpX PU 000L0)QC )A0K @U0 0R, `V) 0S@D@T2"@R0@ d0S 0S h0S 0S  d0  @0L0 )  )AK Pk hЍE-P`0pQ Q 0 R @;P@50 "2   B?"R 0 2S 0 X1 0 <0 R00S 0  @ 2: S@ 0X@  0R@@T "2R 0S9@? 0 R@:/P@40 !2   B?"R 2S X10 0<0PP 0  @ 2: S@ 0U@  0R@@Td0S $0SW @Th0S 0S h0S 0S h0I? )  R C)A K@P0S @9P d0$@Z Th0I? )  )AKA-pP0`QQ@ 0 R @/~P@)0 2   B?"R 2S0 X1 0 <0 0"S 0  @2: S@@T "2R 0SA@6 0 R@17P@+0 !2   B?"R 2S X1 0<0PP 0  @2: S@@Td0S $0Sh0S 0S h0S 0S  d0$@Ph0  -"* R  6  .G-P@t@t  Pupt0PSn "* R  Pub `V 000 @T 0000 LL Q * 0 0)0!0S0!C)AK0)00S0C) AK PT 0R 0V  0R  0P0 L0L ) )AKS 0)000)AKPNLJ@  G-Pp`, B0W057Qo Vm*PUj 0UP 0UbPPPT5VRI* 0W057ZA 000=  0 V`1Vgv B1@T-*0pTpP 0Tp(PP 0 00000 V0 02 P MtE-p, `R0P057XD 000@ ` 0 Wp1Wv 1@T,*0`T`;P 0T`P`P 0 00000 W0 02 `t0@-P@0 00  0 00%  0S ,0S &  0 + ; 0G-@P, 0p^057Z 000 @ U񟗮:; <d<l<<<<<<== `VRI* 0^057YA 000=  0 V`1Vdtu O1@T-*0TP 0T5PP 0 00000 V0 02 @] Z2 0<@@P 20 00D20 00: @8  ?2 . ) $8@#080A3ps 2: S A@@0L?S@@@ 0"@* R  @ tG-Mp`P@04@T/ W\0`00cW#U 0 U 0C0U V V0S   0000C0 pa]P  u_4@ T Ѝ@-@P <0R 4@t 808S @TFp@-\0@`; \ X1\E T, X1P 0 <0Qpd0Sp80Sp 0  003SP<8  0  003SphP <0 0 3R 00 p<0  03\,0 0b0p 0S PU  0ppTp@-`PL@"0P05Q7U 000 2`^ /0C^ \1^ 0^- U20 00i20 00_ 0  0 3R00`PQ+S 00 0J 00 0F 0  0 3R@@`^8T 0* 0"  0S ,0S  T 0: 0! 0: 0`P P`2: S  0S @T  0`pPTQTA-`PU 0|p0 @ 0  003S0 0  003S0 0  003S("", 0 0  003S  0 0 3R00@-p<0M2 PP05Q7U4 0000 @T+ @T( 0p 0 `S! \ L@ 0)0!0S0!C)AKP  p 0)0!00!)AKWp CЍG-P` p  W @T  0  003S@@  000 3R0 003\("", 0 0  003S   0 000 3R @0@0g0A-M`|p"0PP05Q7UD 000@ @T; @T8 0  0 0`S1 \. L@ 0)0!0S0!C)A8K  ` 0)0!00!)A0KV0 `S  0  03Q000`cd8EЍA-`PP`FpV 0 @PU @xPT 00@p`FV0@-@P% RR PE00C000)0 S  0S00 0)0S@CT0@-L@Q 0 000 @0 00)0S00 )000E-@B` <0Pp! 1!00 00 pG@D1!0 00V2``TG-0M0 ` pPo0 pS p;Pe p 00XH 0RB1!007 "0X057 P 0S 0S  0! p101 0!  p101 0!  p101 0X R00 W0 S0 S`E00 0S  0 ЍG-0MP  0P' , 0 03Q ``V0 V`R0?S$2P ',2 /11A&b!R `^L@2 ` ^ࠡ0rQᇁvP@ 0 02  0 0$( ,0P  0 0 3R @@  bP @`U  `V0S 2@ 0 0 3R 00 ?P0 0`\ V2P  0 0 3R 00 P0 0`Gh\ V`2Q$ U( U,  `PP& T0#" P 1/b 11@"l!!  P 000 3RP0 0003QV0`0S0S` $^ "!(P "! ,R "! 6Q0ЍG-`|pMP U@00#*Q"0Q057 \ 0S 0S 008CP`P@ U:`Z00X0S0S s_E00ЍG-P`M<0"0XI V 0V0 /A!b`Ggfffa V ;P3 A+pP, 0  0 3R )@T 0vT` @ "Ġ0 P@TV0Sᏸ R + Ѝ@-`p1@S= S Sr 0"Q _ 0 0S0\P00`0S0S 8r00CS0_`0S0S1 0W_ 00CS05 0  0SpS 0!Q _0S0\P00`0S0S Lq00CS0_z`0SW( 00CS0#_0 Q z_``0S0Qm_0S Q`0SpW 0S0 S R 0,00 H, 000,0000000d <0@-@M0PS %0<0( ,0dn 0S0 @@ P0$Ѝ0 0 S 0 0  S  -P@-` @pT \P00S ^W 000$^ @T@-p0#P 0R 0S PfP 0S`pA-p@ :M@@0Pob0Ѐp` 0!"?%R@4R:4#Q E0 0 t 000៴P@TZ :44#50d0S  0>0Q0 @0@ a0)0( 00墾6$Ȥ,ЍG-P M"0,00@"4@ 0"0<0 X0R R 780R 3 ` 0Q Q  i"*p 0p߇  0p.PD0 `@0 pLJPPPm ЍG-MP L@@@T@L<@@HD0 S @ P<0C8S<(S 1 d0S 0S 0S > S>S  S.@DᕣP8  0@P @'@P, @00004@T*01000@T 0008P@>$\,( i`p0S]@@QMPJ PH@DTP@I 0@P; @0l0 C<P X@7 0 02 02?@ L 2 0Z 0 02?L@t@P  0LR@P d 00 P@>@T@@\% #3<QQ Q<0S P <<< O@R 0R00S X0<0Z1S<@T44 \@\0X0\ X <1$10$11@S @P24@",@@0@00 05T0T@ 2l"@  @Q  2 02?>8PQ^pWT0B00 0 0D RQ\ @n`*"*@ . nGDQ Dp<@ DSH 0f H $ @P1$ , 0P !T020#S@, @ \1(P!( P > R 2 0Z0 02?0凼0@,($ 000 0@@,($ 0T' <\ Ld  ,P*LT Lp @7Y@}8{  D@s8q<Q 4ض0S P 00)  B 000) 000D0S P 00)  B 000)D 000TV2PD0 P 00)   000) 000D0S P 00)   000)D 000 < R <@@  HT $(!T00wTRD@\@x@D@"(<82 , "$0(02@,4@"1(@0.,DT0AS@*0@$P00A! 2 002?PHT05 P0@0P@0P0!<4 0P0  00   .C@L@Q ᚡ0n48唡TxЍE-@0DM  `p‘0@P05q7W 000 0S P` 2 02? 4  01 02 002?4Pn0Sk @Pe2Sb3S_2(S\d0SY 0 RU 3 PQ`F㩠PPL  `003,2 P2 SRP40S 0S0@*"* P. nc `>0Vn0 0>0>0 R@ a0@F`DЍ0@-@0PL0 )  R C )AYK 0 0PL0 )   )AKK00@- 0\ @_ 0 PQ 0 0O0@-@&00 00@-P M@    P  P P  P P Ѝ0G- <0wM X p  \:0S Pe0cq_ 00X0@T! !0  0 0;#;S0>099S00S  0C0 S* 0 @0T 083  @AAA!.̍( 0* 4;A!!! +,,0; 2 02?0-1p x 0"R2: Sd0S 0S 0 R 0004 <0P @`|@0X1\AQ!8C80w?TPQ20" \Lt0A\ P `00T0h X 0?2c0 2?2c11!Bb!!" 0?2c0 2?2c11!Bb!!" 0?2c0 2?2c11!Bb!!" 04A?2c0,H ?2c11Ll  0| `Qd1h!la0匢S ꄩ|BQ8#8SA(A$A"A!A``V@`3 A .0A0A0ZS00B0 x BC 0l#D0h3 wύ 00 2 0Y0 02?"H0@DD 0OTO@ 0 3Rl  ~ Rl\P  0S R  2 02?L@n &`d"?tax1|Ap!PL000Ÿ01aQ`PUN`$P@`V$ 0` 0(`,`0P4`8`<`P >0. SC6B6 @ PTV?0 C $0,(0! `0  0 0;#;S 0>099S00S00004!8!0801 80080 :<0PX @ T V`V NPI @ `V 2 0Y 0ԩln  02?P/ 2@ 0`TV"` L0  0 0;#;S0>099S00S 7P @ TV Q , TX 2 0Y 0ܩ 02?wߍ-x-D0D \M *0 a0 0C=Ѝ0@-@0PL0 )  R C )AVK 0 0PL0 )   )AHK0G-M<0X@ 2 R!0X0 R: p 2 02?Ÿ-`,a(JPu  2: Sd0S 0S 0 R} pn0 <0 h``=P 0! 0RP`5T0!0RT`5! 2 002?LPX 0&03P0P0T \ 0&03Q0T0 2 02? J/\P8 0\  0  P,Q*0 ! 2 002?P R L0X&7P T R \&.P 2 02?/!L p2 0W 0B 02? ݍG- M(!10c $Q10c@N<0 `   03QN 000 3R@N 000 3RPPEV`2FD  p @0003Q `E 0003Q 0PS 0  003S0 2RLH P @ 0003QJ  0003Q` 0S 0  003S02P ЍG-0M  #3QQ Q BQ,(0S),0S&2  !@ .^ 0,  ^ 0R;R: `2!Q Q ,80gS 4RPx!0r #0S  cP)T( 00,0!1R0)0<0. 0 0040!1R 9 0<0>0 8 00<0"`T`2 `x0@00!1Ry0T  <0S P 00)  B 000) 000D0S P 00)  B 000)D 000T'O@1PD0 P 00)   000) 000D0S P 00)   000)D 00028<  2!@ 2 002? H, T05 0@0ꠈhPm @0 0$ 4< 0 0  00   < 0Ѝ@-@00M  p`‘0@P05a7V} 000y 0St 0pP 2 02? 01 02 002? P[0Ƞ,Ƞ\\S(0SP,0SM$ :#:S@ \E \ 00,  \ 0;R7:.,5\P8#8S1$ 0\ 0 \  ˠ0Z}pW@0. N@ R  d0C}p0Wpἳ0Ѝ-ꌈE-@"M0S$QU! 01  QP P  PR0r S S 0 S S0 S S 0S] 0pK_ 0`0/S00 0S S S0 S S0 S S 0S Z 1PP$ $1R0$1  0P$10$11 P R$1!0$1  0s  1BP @#!Ѝ-m-,꤈p@-0@M 000) R  000) P`00" ?00)0 S  0S000) Ѝp@-PM2 Bp 2\0202y@R 0)0!0S0!C)AvK0 $0Aǒ2@, ` 2 02?"L@\ " 4 0 P ʱO `2 0V 0P 02? 0)0!00!)ACK202+@ 00 0Ѝp@-PM 0"00aV[ 2 R 2R02I  )QC )A K$02@, @ 2 02? 4 0 00) )AK, @2 0T0 02?40S 80S@0SD0S2@02$ 000202?Ѝp R 0S 0  0 02004 AG- x!ἐP@U' 2PS!b 8CV 0S  2 2S2S  0S 2 R @UXЈG- h!ᴐ崠PpU VP 2S8C(r 2S 0S 20S @P 2  pUW000Ј0@-@PO 0S 0qNᳰ 2!$00@gN 0S !0002 [ 0S 0S0C002 0PS FN000CS02 h:N2022TT02 H0P0 P000>0xĈԈ܈E-P㘠嘀`p㼕@P0T00dd 000S0@P@ 0  0`0U 00蔥ԈЈ@-hh 0X S C\  @ L20S00S11\ QԈ0@-HH!@P0 S \ Q L00S \ Q@T 2 MQ M QM @00  00C0000p p0PlP@PP z(zM$v?ԈDd܈G-p h(&BX0e "(<M01c a P U U 000000S 2@T(B(@T 2S$0S2SPT2Y QA000W00CS0x=0 Pb"22 "0c80$p !01c0 c0S0  00P"00S0 QL 00  00C0 0002 Y ]X 0S L>@ 0S @T 000000  ꃾ/D>Ѝ@-@P 0S"000  P 00(000  00C00@-@2!X: S S S 0P 01S 0 R QP8Cq |0P00| 1S P0 A-!cpP% 0S" 0`V P T0S@T 1 8CXP  000`V @-A|0@ 1S\ڈ000^ 200S00S  E-! PP/ 0S,  Pp@T hDh0S0 FPP@T PP  0P88#80t 88#ȠS_$ _P g`p8C' P0SS H0S0CH0H`H D0RP`52 002H <0S0b<0<`< 80RL`520020HGH0"0 H0" <0"0 <0" 202h7| PU 00 202[7 202Q7H8#(S $ 8CR8CXA R 20247 R 202+7 08#(S 8Ѝ-@@MVFT0 00$:0PYD뤭Эܭ ꘥ЍG- !HM³`P 0 S $0 )  R C)AK Hp(A8BsQA0Q S 000000S2 B8 S 00000 BH  0)0!0S0!C)AKA0 P80@ 0)000 )AK88#S8 C8 S 000000 8#SY0 0)0!00!)A~KЍG- p!H0`P8C( R 000PU $0 )  R C)AEK@tS-1p@tI 0@S0S>  2 @: S7,0 @DS3 1J8 S 00000 JX A0p$0P P  ,0 L   000 )  )AK㲢0 )  )AK: G-@M0@T`V)88 S U(  U  U!V<0A/ QV  LP, X14 , X14 0<0Qq pT U U -0sd0rBVJ T\ U'  U  U R U  U M U  U G U  U B <d8 0 2  (%  P8CHP 0T S 000000PU  "( 0Ѝ-02 @-@ A?`P9A; Ax\ 0\ESKPKP Q0 X19 0 <0 R H0/R404 (0(  0  G-@@PXϠ\M 0  0 3R ^ Y! a0SC *R |P v2#0S \ :  k0Sf$v5  (A(Q0 0 0 2 "02kpP> 00 0 0 3R  dP* 1*  0S"0Sp0封  Qpp0pp05(300@4pW0 0h B0 2"0C h2" ᭌЍG-pPW /R` 2 AQ  )蠓0* SIPVP*  QQ 0S QQ 0SPQ  0RQP  0fRPU\ 1W*  Wp! Ul`ppp0$0\l`$DDD Q 0S 0U20C28#8000053!00b0  B 2!0b23  000 3R00Q  0  003S ^ p `<0 R](R4]p--M4ЍA-Pp p0U\`1 @rH24 r r 0W0PUG-lp 0MP`u pW>800@PP3 /< 0A? 0 93p000$0(0223300 @ 0Wp00@ $ 2p Ѝp@-P@Pp@{`v pp@< Sp@0A R*pAP p0pp@-@ Q  0 a00 0T0a0  0S 0C!0r 0 !00(2$21( 0R $00R0S$ R 00R0S@T <`0@0C0Tp@ E-p`PXMV0?S"p0F S񟗇t            U 0 V10)0=0>C   0t3t#p3 p, 0  03Q  9\3pU 3 pX2A R pIP 080 < 0@024243538`5C, E 0匣03Q `V p pU , 08 03Q  U 1 Ap0S0pGSV1 Vj V pIP| 080 < 0@024243535C, E 0803Q  ^ ppV<0A/p P 0P X1 0<0QA 5 S X14 0<0Q3 5T32020"0++<00 p ! pA? pP 0P X16 0 <0 R ppXЍp@-`@0@@@@@ OP000000`Tp $(A-Pp p0U\`1 @rH1 r r 0W0PU$ G-Q M [ 0 0} S 0 P pu XI1,` 0H 0 0很@P $ P00i00 0 V O,0 00, A? 0 d 0 0帒 D 0X404  @ ( 0(p$  ЍA-`@PX T epw `  ~`< S` 40A"XACP `0cG-`!Vp !*0PAU0S#080   0  0 0  e 0S S  ^:$0S N@ 0$  !@0 @ @ 00b0  0   000N^*pp@-`M@T) 0S#  0$PP/U$0S 00 0P0 R 000 000@TЍp0@-@0!XS \ !0 S0S0 @\0Q00@-@0!XS \ !0 S0S0 @\0Q0@-@Q  0`00 0T0a0  0S 0C!0r 0 !00$0S  0S@T *p`p`_/@T@݇($G-`p&M  Q0? S ZZ2 Z ^Z\Z0},0z0  (0,$  0#0C408 <3#4< `, 0( 03Q 1\83`,3 W3A R `IP0ÇD2  H"B, E 0,P03Q  P`U `p"A`0S`F 30rRy PJU  `Rk*010Z 񟗎44444444@@@@@D `IPMUx0`B`? !`80!`1X!`  X+*SA? P 0P X16 0 <0 R  `,  0 03Q P@ T\ `^#*@0 R^:?$ `, 0, 03Q  ,\D1*`T0 S0JSLttttttttttttP `IPP2|p^ @ 100^ ` 0 0 3R@ \ `P$R\   0\ 0nA? P 0P X16 0 <0 R ,#t< $0++<00 ` R`P `IPJύ0`FD2  H"B, E 0,03Q  ᥾^., `_P'^P*@0 !^:$\ ^*  0^:\00W`!`p`&ލ@-@<0u?P T@@ȅ0P w<G-0PpNM 00Y0?S YJA 0 0 3R 8 ^"0av v 0JS80Q*0S*0  P 0R0 00R0 Q0:  0 I PU' As@@T 0ST20PỄ@P m U Y0 0p10A$00$@@8 0\PPRPM8 (`, 0@0\ S 0 4001 0 0 P  000 00S   0 0p0SQ'0P$0Pd-$P8 \0PP01 00 R 000 000 R T NߍG-<0M!0R Q 00Q 000 000 010au/ VB 0s5 T0 QQ/0S,$0$ S V  0S W;'(0@0rᐐT 0 0S0@\0T0000 0z0`V 01pЍH0/R404 (0(  0 L8@0,<A-Pp p0U\`1 @rH, r r 0W0PU8<G->0Z#f Mpڰ 00S p 1@t pW\<00zPPP@+ Ou~P4 $@x+ B,P<@08T 4 01@T 00000 0n`:#:S   n`0006Sv1cV@ V*06BV|  0Psf0P 0U00Sn LJIPd*  X_ A 00PPW  1W0S *  I`40400060"Y 0?0Y00<1 000,0( 2p0("Q2:8P 20C(20  t\80S 0 8 0$0808P$00T 5200 `20 )  )AGKpЍ40 4|lc720(20C280S 0 8 0$0, 880$0<052p-p 40Q4$0$0$ 0, 0%2"0 0C(20 pp@-"P0@ )A\AC)AK\` ( l0 @R,00cS`fT20 )  )AʸKp\E-40 ,3bl!?p 00!fV:40A0 ;PP .U40A T  H40A ᕋ 00C0!0@004 A, 00C00X 00 6100)  00 0)40oG-!M0Sp; ͊`P8  0䐟0S0  0  R R00000 \*4    T 6 1! 8 0pW00 Z&08oDt!6 1!@QT a筅{40,0C0$0 00 o0H4Ѝ-!4h"&!  )  )(  ӊ 00C0o04@-@Plp` 0S00Q * 40!R 0@00Q:^@-@M0 bQ000C0 jĮ0 aЮЍ@-`@Mp0Va0C6S>H;T;T;T;T;T;P;T;T;T;T;T;T;T;T;T;T;T;T;D;T;T;T;T;T;T;T;T;T;T;@;<;T;T;T;T;T;T;T;T;T;T;T;T;T;T;T;T;T;T;T;T;T;8;4;p1N A0AS020CP@0Az^{N0?1ca 10Na0U' x "H0AS H 00AS 0 0aU  0Pּ ON 0˼Ѝ0@-@ M,P (\5 Ѝ0- < ! R0 P  P P  P  P  P  P 2E-pHP M0!S 44@0 @0!`v@ꘉ, P4L 0S P 0P @1S 4DL Ѝ@-P0@ `1 0p!0S P 000 !P 01#@-<81@T? ,q 00P 0 P  0PU  "! s 0PU0S P 00 !P 01(@T00 R $0 R @w@qu#@1G-!X0! M   20C00   00dS040  〛P $ 2 #RoO@0 0! P 0 48 pO 0 R R RQBX`0 48  0$( 0S0 R*: 0R%0 S S0 48 <ᓢ"00 }l0 00X 00@X@@D  0 4 8, 0 S S S R@XX6 0 48 < 0 48 < ! P0 Q$("X0 48 <ᒣ*. 嗚+U0S ᎚ ЍG-!H`8M  ! B 0 㝚PP3TD#$41S !?0R¤ä$0 02 "Q 0S Q3` Vo_Pc1US "PY  TS t"PM  R .L2Q @"0S0   "0QS SS"ѫ.  2Rp  0$0(< 0?0S0?0?S 0@Q Q QQ Q`!ᦫpWp   0 1  l 0$0(L 0 4 8< !"0R 0SpWpT 0a00 0 48K 0S S@ hUU@0 4 8< #"0@ 0 S S S R T200  ! !20 R00 `PpWZ 0/R,pk_P 0#  0$0(̒  0$0(<  Xp0W00PE ,10S U8ЍE-p!XM -P1L`$NO<4<("4!<S ; *0,$,!$#, ^*P z1X ՘A `P  ( "<4<("4 ,,< `Fp @PUZW1X ᲘTЍp@-`B : S S Sh0S 0 p 0  p B?"PQ$C 8PA00S X10 0 <0 R pV : S 0 X10 0 <0 R pA-P`Mh V:hh 0Dd@Bpt0AT  0/XlX$0@ЍE-p@P M`P  pHP00 0p00  1 PЍA-@Mh0`V:0,,!0CS0 R 0 RZ   PO7 X 0S  R1S R0SR0p PA 1L \ @W`p#7S07TlhP 7C\ ڼP 1C 1L \ @ hЍG-Mh`Vt.00S џp00 X:0   0S0  #0f@  TP@dap᾿ 0S0e c07S 0S0S h0S 0 R0 R8P 0!R  R0 PP 0" R:0AR R:0AR X:\000CXAQ :\000CQ!0P@ T*0$ 0SPDL!0w 0S !000  @ T:@FP㓖(0S ᤖl@8Pㅖ(0S ᖖ*Pw(0S 0  ⶕ0 \ <ꌱȱ@0000 ЍG-,M h`LV 05/L0S ؞pPP 00R L@B/0Q  B0S 6PX1 0<0PU0P 0R :0^: 0TbK(@ PP 0ST  T`7pS 0S0Sh0S 0 R0 RP0!RP0!$ $!01 W ?@?@ ᐮpWT $0 g $!$0$0TcATp1d: yT0@Tp1r:h0@T *X# P 0h S@0T:T:@7S 0S0S dR 0 R0 RP0!RPf0T $!$姳$0$0TcqW:T0pW:#0@N@W$@pW00T0S 0G$ 03 @T 0B  !P0 0S @@Ly00T0x! 0 0Z 0Z  Z :\000CZ" 0$0$ᣯP T\"00S  !QM  0 S @ 0T003T 0S/* PU 0BϠ   !P0 0S$0$cP 0S  ! @ 0T00T 0S:0 0b00  c $>P$㋔$(0S 0 $ ʓ$0 0Z :`l 0@s @P$, 0@dꈲȲL0 Q $0$啮$㇗$@P=(0S N$P 00C0(@ۮP((0S 9 00C 0l@ɮP(0S '0@0@L0 @L000L @0@,Ѝp0 0@-@PP0T P2@00@-P@P PP P0G-PM0S Z  h@d00@00 p S * P 7S 0S0Sh0S 0 R0 RP0!RPt 1q P $0 !0` 0V*@$ 00!0 ` V:p0 T$@` 1`"LT!0p0 T$@`1` !0}\0`V*Tp0$@ bֻ!01 0f\0`V: ,@\ p 0@T   h0 X\: 0S (@ B00`|Գ,dЍp@-@Pp^ *0P$` 0#2!\ :p蜉0@-@PM  R T@"H@0 00P4@^ $0h 0c 0S @   D^ h0p X0P@@T 0@00h 0 0 TdxЍ0G-dM000,0@_0h0U 0 0 0C0TP  1 p  0 P ` "0  h0@X/ P 0 BSBTp 0 P 0$0PP @DTU $ v@T$pP s@TP D0R! @TT1 *$P0 S0@TT1*P0 S``0@ 0D0P0p8$ 0TP P @0 `@  Y .H̵ܵ0\  0P@ PP0T0P``Q ,0 Q0P 0X:Y PQ  ,0 Q(0P$dЍp@-`P 0R0 R,0Po P`0@Q p 0 U0V ` 0$00P0p0RG-RM, p(0  XC*}h  0w: S #2 0"S  P , X1 0<0Q 202, 0 , ( / Q(0R z zZ jY<0p!0 r 0S:jY '  >0>4  0 Z3 A` Pf$0$0 0P 40 R  U P!0 0U00S5 0300$ 0 0 3R k 0PlU 0P00_0P 0S 0 00ߓ0<00K(0 00 ُ00 00P Ґ \ r00$ 0 0 3R  P`U 0P R  V ,<0@PV(0S g 0 0 $ p \, e 0p  0 80!0P  R8 x`A800 X80P k `V00\ `Y$ $ P 0S ?  8@ I`VQ8 0 &80P >` V,0Z,, 0  >0C>40 4 8  ( 0 pЍ-1 1S 1@-M@Q6h0 xP/ T 0   ؋0P T00  T 0 P ُ ώ 00C 0Ѝp@-` @ PU  P h0 0S0ppA-p`@ P Pp@PUZ@-`Pp0M P0S h0 @"V *0$ {Ph0` @"T:P Ѝ@-`Pp0M P0S h0 @"V *0$ Ph0` @"T:P YЍ@-`Pp0M P0S h0 @"V *0$ Ph0` @"T:P 3ЍE-@2P: S@0S `̠ЀpkP  wP P P`V3PE-p@P M`PpG  P00 0p001| PH\ЍA-@Mh0`V:0\\!07S |0S0Sgh0S0 R |0 R  V PO7 R |0S | R1S R|0SR0p PA 1L \ @W|`p#8S07꠶P x7C\ |P 1C 1L \ @ \ЍG-`M2hpS|&Qh&2S T&W@&0S 0 h0S 0S 0S t!00pX:0X u@HXP jP -Pf0"* R@@0$MP $$ 0q4Dlķз  P 0T00 10C1@;P㈍(0S ᙍ000l@*Pw(0S ልPi(0S z 0  ᨌ0 00000ЍG-P M  2S0PP 00h`00h`0S ˕00:0p 00 0 S00  hbph0@XM* P 0S SZ 0Rh0pW:5@ P 0Spph W *0bX! P 0S Z0pph0W *X# P 0S Zx *P @@j 00!X$ YX0pW%*0$PP hh#0dqDP㑌(0S 0  Ћ0 0SS "0X0 ('W 0W"0p@@0 Q0C0101@PK(0S \ 00C0l@P9(0S J002B?h` "02 22  0*; R>02:@p<0@@0 1 0 18 0 4  : S0000@@@@@@d@ 000.0000 00@0S B?  P 0 00R 0 (8Xpć0@B y00 Ѝp0E-PM0S ?p`0h 00pW* @P P0X@\ \\ 0@ ph0`V:0S $( p 00$ĸ Ѝ'@-@00CS0x 000/h0S 00 @ 0,0R 2p1-SA? p@-PMh@0`S œ!R: T 0S4`01h0B1 Ὴ@Ph 0S 60 ;h0 Q $N@⪥P(0S T >2: SA/<dx 0``ЍpA-`hPQ q,! @ $ 007U! Uʜ0 PEU Q  &P $0APhUQ  U'P $0AQ h0 0HP $0AۊPbQ  U$P $0AˊQ h0 0HU'Pp $0A绊Q h0 ڊP $0A箊萹G-pP 1M h 0 @T h0 0TZ P  R( 00 0 SpW@ZJ0@TJ!R pWh pT0<'( @P1h0 ṉ0`S  V V@h@L0@ 0P @ 8 00>S fp0὾ЍG-@`Mh Q$ 0 0 0P 0$ PU 0( \0pU8PoY0 00P 0, S@T PZJ PUJ$01S @T0@0 VPPP ։0( '0pS  0W ĉP@Pi(0S zh0S 00>S  ⟈0 0H @0 0@08,0PP0 pЍG-`QPMh0 0!APP! 0 # 0 009V $! `00V0`00p W00 0L `GV *  0h0 9`dV"`b 0 h0V, 0@Dh0V) 0h0 괹  0qh0V) 0 Dh0  0ЍE-`pM@@vP= W$ 2: S @0Sh 1 p0 PU 0\@PP ވڈh0p PU 0 LJ0 0@P 00ЍE-PM0@Sh0!@P:h0p @P#0 X`@ᕯh0Z:# 1td :3 Bp XX`#} @ݰh$02 6N᠈P@#h0d h  0$ 0C``0212120,0 0 080 4  !:<0 000D0 !@ 00p t0 0u  h0 \0l00l01l R0,0d!000R h! 2: S Sbb S @Q @(!@0T0@(!@0T0X 0 d 0CS2: S1d0 S1d0 S0d0  S0d0 S0d0 S0  0 000  0 0,0 0 0 0,0 0 0 0+0 й0RL0,ЍG-`MP h0!@P:h0p @P!0 X@‮h0P:! 1td 03 B\h!g hP$@X@į1B 07AቇP@ ,!h0L {h 0$ 0Cp20202121,000  80 04  @00  0 0 p 0t0 u h2: S01l00d0"* R R2(0 R@Q@(!@0T0 tй@(!@0T0aP㮆(0S Z  0 т00 ؁  P ݆ ꈺЍ.-*p@-P`0@ 4  1" " R00S 1," " R00S , X1< 0<0Q B?"Q X10 0 <0 R[ 0  0p!SpS00 r0S  p`P?U0 4  0 0 0 0 0  0 ; 0 ; 0  0 < 0 < 0  0 < 0 < 0 0p0@- R 2R 2R :R| @<0 0003S@0 P<0 0 3R@P0 U 000 00R X1< 0 <0 R0B?"Q X10 0 <0 R h0S 0 00000 00000  0<0<0 0<0<0 0;0;01 830 <0 0 3R000B?"@P X10 0 <0 R h0S 0 P 0  003SP 00U0o00v@f@fpG-P\M R 0Ph  <@ Yp,0W 0P<0 00 pW0 ,0S,0 pZ~*00SY  -W0000c< a?0V 0`0 0\  $@ 0PT1* 0S&0R P  PP  0P: P<0P P PU @50S(@T:V ބ0 ,0S`갺 0I` V>000c< a 00 a,0pZ:P<0P PU\Ѝp@-PMD `R#@@ 06P 0@埄hq@P  ŷЍpG-@M0`P0@ j 2Sg Xhd ,P' 00 pPPZ 200$@00 $0 0T&:U a 009TPP> , PP0 00$@00000 0 , :0Ǹ$@ 0pPU0000X P   PP U000 R0S0 S*0  00 0R9Q 0 000c0  @ 0000 0:084lt 000D0;P㈃(0S ᙃ@0 00@^p0RЍA-Pp`M0$@U* D0PP T W 0 00pкp 0P@U:ЍA-`P0M p 0@P T R0d d  p@D 0P  20C2v 7ꤊ00h 1  00 000D0帝P(0S h0S 00  >0 !P :᫵0RЍE-PpM ` @Px , B? B?C"rd0`@D 0Pi   000D0"* R1d0h 1#  0 Rx1d0h 1  0 RP1d0h 1  0  Rh0!  00: S S0[.P{(0S h0S 00  ⴁ0 ~%P 0 0  20C2(᥺0R,ЍG-`0M 0} P!* @ 0 0PP 2h d0 @ 0@,@q@P  20C2r $  pp0`" 000 h0!00 h0  B 0#$0#8 0h 10ᘜP(0S T ,<0"?;0 )"2 ;20ᡶ@D 0PC 00h 1  00 000D0\P㩁(0S h0S 00  0 }0"0 ":0^HP Ё0 0`0W0RЍG-pM,0hS @0PPh00!0(W$`0 R 0S PP h 090 ,@`T2*U $0 0V:U ႁ  04uPP 0@$` 40@JP 0S U g$0@`,0T:U VЍA-pP`M@D 0Pe @h0S 0S 0 pQT"pGoPO jD!pP000D0D‛P̀(0S ހh0S 00  0 |2S h x000D0 02,0zd2 0C24 8 8 0:0jP ݀0RP\pЍ@-`Pp M@D 0^P_ @h0S 0S 0 `QN2S088!h'02`P= !000D0PI(0S Zh0S 00  0 e|0| 0:048 20C2`8080rP eꀻ0Rp ЍG-p ` 0M @  0PP d2h^,"d0  BV*0S Q*0S;Q 0*`P  20C2᮴+$h0@ R 0S 0h0 @ BT*0SV00 eP(0S V 0,@z @D 0ZP 00h 1  00 000D04P(0S h0S 00  ~0 {P  '0 0b00RЍp@-M@P2`: Sp 2} Sl*00@D 0Pa 00h 1 2: S 0 S 0 S 0  S 0 S 0 S 00 000D0P(0S h0S 00  G~0 *{P C2D 0208ῳ000妱0RpЍpG-`@pM@D 0 P0 0 0 Q@0@D PP U h0S 0S 2: S!U &0 0-P  0 P $0 P0W0U0S  2} S*0S  @D 09P lAl000D00 8 A00h 1 0  0U00D0 2 0C2080# 0:480Y0 $0 0P 3~(0S D~ 20C2U 20C2 0Rp0"0 ":0⸘P~(0S ~h0S 00  >}0 !z☘P}(0S }h0S 00  }0 z0 0Y ~P ~P ~ Ѝ -p@-P 0`A p 303l@XP}(0S }00 H@@p0#R 0x 0x @0q p0#R Pf 00 0Իp@Ѝ -@ 0`A p 303lPPU}(0S f}00 @Pᬜ0S00 00 0x 0=p@Ѝ -p@-`@,P ␜mx 0 p@ЍA-` 0A?p 03l@P}(0S }@p`P܀Tt0P N}@Tt@_P C}@T@P ;}@TlP 4}G-pPM$`$CۚPP =HP 000hdP000H[@PP 0S QPf LP000CP0007P000.@P'P 0S"P0`000\P0P0 008P000@00sP P000P000P000P ܙP000zpә@PP 0SH,  ᒚ0Se $. Ἑ@PP 0S  {0SN ᥙ@P3P 0SC  b0S5 |7ꄾHLT\dltؼ$08@HT\ <dlP TgP DbP 4]P ᾙPP\hpxЍ@-`ML0PS` 00 0 0[A?08 03( J3"S:p~ꬾ8pDpQ @0 0Sm3#08#8R303303l@0,0Pe{(0S v{@00 PPD0h TX@0P 00 @0 pԿ`hЍA-`p@Mh0p VP5*d٣Pt0!$p\:T0 \:dd \:\:@D \:\00S : 0M tP ph0`V:ЍG-`0p@M帐 11 y PP[ 0 0000Pp0S q   y U  np  8{P0000n $0p#x3R$  Z0 uT @0@0T0S zL0S `0  u 0d0  up 0 00 02 S 0/  S  S+ CyP 0S|5:0S z  ry @ PEᥡp  zP  $0p#1RL0S T0Q1 0 1!\01` !d0 1 ;QD rH$ 0 @T0$ P (PXPe0L0`\!Bd@0Rl0%< !R11% #A? ,!8#8SA(A$A"A!Ad 8#8S@(@$@"@!$ 40@ R Z02 u ,(SL|<l 0\ Z0 u DR 0 T!\ pPQdXQT00 c @dh@ܠp8[Pt0}PU0"0@ yt0t 1S@Tqt0P y@Tt=\Z@PU!P@Tt0P y@Tt#\ @P| 1PU    @0GG`p00㸐0VP,"PUt0P ryPUt[ R gy,  LxXЍ0@-L0 P0 l@⨓Px(0S y000p@-@ 0 p3 08$#83 ,  00pA-P`p@M0p000 0  P8 00 0 p` 0Q0* Q 3%A?0! \ 30,0l@OPx(0S x00 pA?# 0 0Ѝ- G-@@M0 p 1p p `Ph0V *P`h0PU:h``0\ f! pp'0 p0 00g0Tp 00c0 P0305p0  $ 0  0 3R  \ S@ЍA-`pM@@0PS  0]pPᕨ $PA ᓒ`W RxЍA-Mp`h0 @0@RP1P!S  04PP#$@T, 0S @T0S 0 0 3R  ធP @X xЍE-PMh @ 0$#a0p spT 0 spW W0S, R 0S%T`h00 @0 4C@0`P wT .P{w(0S w *ph0S 00 0   v0 sP wЍG- PM h , 0 @40剞p W71ᜀ pg`V. h0 u@P 00S 00 yw0000 @0 0b@0T wZ 0jY   pWZ   ЍG- `M  P@0 Uh0 aw 0pU W 3wWP!h0 S  Pv(0S v0ᗫh0, @4"!0 PQC XNA0$P rPU? h0 P 000Z@P P 0S   \I@PP 0S   0S   ᕒPPЍp@-`B h0S 0 : S S Sp 0  p B?"PQDC 1P@00S X10 0 <0 R pV : S 0 X10 0 <0 R p@-0@P:D S&:$<0"!4!t 0! R \0SR 2SR P  P  0Ppp@-`@PT @0S < PP3 h0S T@ 0S 202020S,00Sd00S2 R 0SP L04 R \0S 2024 Rp p@-P0`S M| ; 0 @ 00$@@P oP, &( 000Ip8 0@0@0<p$4-+0@M 0000T 0$0 , 003Q  9^ ꠟ@Ѝ-;@<0 !L0 Q80004080d,,2.4. 0Q \0SQ0 \ X0 A?0C/2 " ȠȠ"R 0\05 7Q@0D ʠ,0d 1=21202pph0@-,P᳋@ T*j 00輋0@-@0PSP 0( 0$P(@: S 0SH00000 S0S 00S000-P0Q@ R P0 S0S 0S Q0@-( (@\ 0S 00 P P* R00C0 D P*(<0 \0輋@-`PL@L M p\ % 0UP 0 3R Kh Ѝp@-`P<0$ M @\  h ЍpA-Pp0@T! [`P 80S P, 0UP03Q z[@-p`0@[PP80S  ᨌ@][0@-Q   .1 (x1xlA`!0X1>0:0@80( 0 R @ 0010 00$LԐ\8u<uh(ol8|HДX$` 0@ $00 P,`0P@ ((p`FW V p`FP` 0  P  0@ pWHLЍ- @8 4 R \0S PZ 1\ G-`0dM@PP0 @p W$*  8| L/C!b@R0   l 0 P Pp@0 W:gfffdЍ0@-@P0@  @0PRw0P-0| #ȠQ,4,h 0Q \0 SQ X0^00S A?C/ "p@-@|tld\TLD<4@ꔗؗ`,p<R- 0S0 S PG-M  pX`P  x 0S  n^ i0S00Y0Sa 00  Y P1[#R  0  \@T00 00SD  ,00@0S0@cT000T@T, 0, S!1 003Q   @T  Q: ? ? Y  0S00kXЍ-004\ ,0 Sp@-`P S S Vp0`p 0@T 0@ppA-Pl@p(@`e @T  P T0P/KPP@$@-!XpRM P+|`E^PpP# DD@ ⌇: S@` :#:S[_P 0 0HSY:#:SI_00PЍ0-:C S(P0@-QM P%<0(@P @T  P T 00<0@0\0  0KЍ00@-@P5P 00S1  d\ Q 0d\ Q  0R1\ 0, \0P @4 X 0! R \0SR 0 0St0S pG-@ P `pP 043 P$Q. / +!&5?# *"*JbT@ 0 0 3R  ᠈`PpdW , 0S2 &*Ai0@ Pmp@-`PS S 0`p 0@ppG-M0  gP   ,p 0C 0W"P,*l`@ PU 0WU   ':Q ?0;1'%/Q 0W*  0!0gSzW: pP 0 2R l1  2R@1   0R*U'' "ʠ PU 0W 1 ?0;1 1  R!6`@T 00 p $00C0T @D,04 A  @PPmm?0;1 ATO 0 0;1PE 1 0  0-1P7  8080 "P*0!  )000  )z 0Ql: 0 2R <0 0 2R0 0PmooЍ@-@PM01@A$!$1 ! R \0SR; P P P 2S/ 0%2S* 0 2S% R" 1  00S R  "R 0P057Q 0S \ 000 pA-pPoU`P  \ 0S2 : S  S R  @ᢌ*ߟ@>D0CcPpy, 003Q Ệ)Ut0@-P@ \0pS  0p@-`P08!#00S0^0SDD@\00S< 0LS @00 C R31/ 0LS.4. 0!R R \0SR "R 0P057Q 0S h @P 00P0CpppG- M0p0  .^p`VP@ V .Ƞ Ƞ0 P\`@0 V)4)H 0qpW \0 SWF `F"R<pR 0V057Q% 0S" @ XɆ0@D!10@R000  d  0 P0W\0 S 0P@ "`R 0V: Ѝ, X18 0<0QG-pPJJM `'$0$ l 06VP:Lo0fUP!UJV* J?fJR@@, 003Q  ህp`PdU V*Jf, 0T@!03Q'p`PdU F, 003Q  ]0OJߍ@-@`4 M0( 0\010:68R0 100PmE-@`PpT* PH 0S`U0P@TS# :#:S-L4,P 0P \0 SP 2SLP 0p-L4,P 0P \0 SP 2SDH 0pP0@- <0P 0S0 2 S  DPD@R:RP:P0 0S 0 @-P2@S p?`P21  ! P 21  ! `VZG-@HM4@@4 0"0a`V \0SV  n/ ?+00@0,8(\n$00AS0 \S0 SQ 00p `A  @ t0HHH\\0   $  C/P @Π@@ @k1@U F0 P`1@UY@Q= 0Q: PpX\TP# 00@ NS"!0 Pp\T F1  0p P ! 1 egP p@P0 @@P P,@P$(  pP$@PPP(@@\!0`1X40@c(4@HЍG-PME4%!0A@T \0ST ⤀0XZ/ "0 0p`p0R+ 1R( R  0C `RB/A0PX0 `!`1 X10 0 <0 R 0 p m  !R0?0cl0  8,8#p\Ft0\  `00h  00  0 0 $ 0(0 , 000 4 0<@D080H0 nL P`2ST0 T0R !X 2S(0\02S,0`02S@0d00 lph021p00!| 1x0 t0(0 L0 0(0lЍG-p M Q04Y*@ 0aPUV#0 ``Q:  @040Pm/ +! 5?@^#ʌQ 000 000 000l0 !P *\0!0S, 000\:( @P:0#Qoo: ЍG-8M $@4 !0aV`V \0SVL "R; 0R8 PU5 p40,–  @0( 4p0p,p(pe400 , 0 00(0!    0SpF PU $, 0 CL8ЍG- P@8M(0, NP PED4$"0Q \0SQ 2S (T"\00P0S0<0Q00SPX Z#&X0z D) @0X W PZ  ?XWZ 01 01 $-r -w -x ps  -i0@000PS *0R@1`@ V`1 00`B` , @夅00@S P1U F 00P1U @` 00@Y @0p(pFdPi (0UP! 0  0 3R  Y (  e ( @0p(0S \$Zs&'J6X / , PbM8Ѝ-A QN <LT\d(lt|D] &YZ  0 }HN^,xlp J!lDTJ 0 0@-@PA4! 0!R R \0SR A?, PX``1"@@@R\0^ ^ ^0, X10 0<0QB? RT0p0 B R,,,,, $LeG- Rp1{#M `>MP ~ @ P1`$X@U P Mk0S 0  U 0   p`V LJ PU , 003Q  w~p0O00O T 0 R L% P@ U0T0pc@, 003Q  C~0O LЍ0@-PM@ 0#0 S  0Ѝ0 - -- ,0-RS 90PAddA-P`@0pƃ0PP0ecP00G-pM    aLP > KL9X3@0 X`k\ 0 0`00    0PU 0 0 0 3R  }e/U L ЍE-pP UM0@J(0S  L`P  , 003Q Z~ 000Pp@KЍSp@-`P S S 0`p 0@pppG- p`D2:* S@0 202021p2 ,1<R@08),0 S`, 404 S`4 V&4 0R2 : Sh0d Q h0\ Q2: Sd0\004004" 0h@RH-TxV @P *\ 0 0 P 0  h0D0@.`P`@ 0 `0 L<T!  @ho @4?d3sC40`0248Co ЍG-P0`M00h0`P@ l1  0@ X @S<1 0 0 b0248!!&! 0PV@1 0T\D pP+W  / 0P 00,0`dU,PV0? 00, S0 5P 40R*LD QP0  40  rh o8`0S`ЍE-PMt0 9` 0h Dp 0; @-00)| Rx  |`000)00)@ 0LDS 00)0 S  0S000)   -Ѝ-M : 0:C .ЍG-$MD p0d#0 0@ P @ , \`0   0sP@U``9A?Sx0 S0S K;@T`V! t0 S@0 Ph0 dIUZ!3 :X@10Z d  d0@ 00Qh0P  R* 0`h Dp!0 @  0@0:@P> msPx!:?p1H@@0A 0S)t0\ x倀00 !0  R@@@0@@ 00  0Q :`<;`Vh| 00)   000)0   t0 h0D P Dp=L P0Q h(X N4M Q*0 ?RpW h D0 @[,;,0  0dd9 p0 Sr PR |@P Pꠡh@TPUq00CS0:$Ѝ-909< 0@03:p@-`P@T U 0S@Tp0@-@000=0P0CS0q:0@-@P P 9 P 0@-P@P P 9 x0SP 00@-P@P P 9 t0SP 0E-`MHpt0x 0 0 @ @0I@P P9@<9\  0 L000 n Œ Č Ȍ P+hoЍG-pMH@t Px`$!0  0@ @0P9UP,)!>9LP4 40R:0, S 50( S0,04 4 tr;9 p N@P0 , _0 T 0 hH 0S <0  B thS| 00CS09ꠡЍG-0 M0@ #0  0@ @&ß 0 cT0RDp5:JpWT <0 R ( `0 0o`p@ `2R 0 c 2R 0R  \N 0SKŸ0 @\  40R0 0 0  0S*pS*p P\, * 0S0SN P* 0 0 RP:0   `V |0 D 00 0@$PZVF PU(0 40Aq!0 1c1a317cAy 000 0 0 S  p?@P pT @B  : h\ DpP5 p 0 `0 040 p0   h@R 8(   0\ *@ 0"(( Pp0@ <0 0 00 0hL8 Ѝ@-@bP|0  l p0S0S  0 3Q0 0 0$@pGwhh@-`pt@V 0R 0P P 0LLS 0 0P ? P$@pGw-0  hA-P`hMp @WX1 T4L1L `KQ0d00`SMEBP 1 D @@ ? U5 0 040`SL 0  aR"T\@H`0@@ DHP, 0R\ sP 0 00R ᶇ0S 0L0p@R h 0P ;W 2: S3hЍ@-@|0  p@ 0@,   0   00P  0@ @ 0h(H-\PT7A-MpW 8G `G44 P 0,@@ U@80pWtЍA-`@hM0  0@ @D0#PS+\0PS 6P\! phH`@ 0DP\0pPu U P P Fቇ0 PL h<@RhЍ0@- P@P u0 PL 0@Rp@-P@`M0   @00l`x0t0p00|0|l0`h(P @ \D`PP P 0  00hЍp@-P@`pM0   @0V: S S0l`x0t0p0xp0|0Al0`h(P @ \D`PP P 0  00hЍp@-P@`M0   @09 l00x t p |   00l0T@ D\(PThЍp0@-P@x0  l @0@ 0h\DdP 0  002S0C20hp@-0B|P M ` L| c>0#0峆@P5@P PP H Ѝp -LPMMp, @ 0 0@ 0@0S000Kh0S 0@ @0`= @0@-t@D 0!t0 @ j  `v0S,V,0h 0@ \Dp08P@0 L 000܃ <lTx@RA-@ Pp1  @@ 00`U 0@ @(\ڼ 0@ @ 0$ Q 00  U 2S0C2t@ 0h\D`V00 ቆ̅h0@-@P\0  P @04Pq P0 L 0h@R@-P@`$M0  ` @0#pp P40S 0@ @ 00 00000   000h @ \DpP 0  L h0P@Rw 0@ @x$Ѝ@-PpM`@0  0 @l@ @@0s0  00b\@0 T\ DlP202hЍG-@pM`P0 00  0 @@ @@0?0VS @⮄pPW P@ `ṅ \`0S}0V0\X 0@ @ 01h Q 00  V e T 0 @ @\\0DZ wẄY 2: S ᄅW m Ѝp@-@P`M0  0@ @ 00 0T\D@P0S` 0  0 3R l@3hHЍpA-@pM0  0@ @ 00 0T\DPU` P53@P  gj0`3 lP33h`Ѝ@-P`p MT@0 HY0 0000]%P0 Jh Ѝ@-PpM `  T@0 H60 0000:%P0 'hЍ@-@M`0 p 0\P0 P0 0000%@0 hЍA-@`pM 0408@0`P0 T 0@@@$@0 T00hP 3ЍA-p`$M<@@D @  @lP0 \  VB?000000$@0 h0L$Ѝ@-pM 0`4@`tP0 d TB?0000080 $@0 qTh`LЍp@-@ M04 ` 0 \P0 PV 0 0000Z$@0 Fh| Ѝpp@-@M  `TP0 H2 0 0007$@0 #hЍp0@-@M (0XP0 L  0000$@0 hЍ00@-@M  TP0 H 0 000#@0 h$Ѝ00@-M ( @ XP0 L  0000#@0 h8TЍ0p@-@ M04 ` 0 \P0 P0 0000#@0 hl Ѝpp@-@M  `TP0 Hv0 000{#@0 ghЍpG-J pP$M8`P iV'  X@1J# D0 pP` 0R @h@0 \9P 0PPP=#p0 )z8h$Ѝ@-@`p MXP0 L0 0000#@0 h Ѝ0c `0@-P@ @0@c @`@0p@-P`@<4<("4!< 0 P<4<("4!<0 @<4<("4!<0 P <4<("4!<0 @<4<("4!<0 P<4<("4!<0<4<("4!<0 @<4<("4!<0  b `pp@-`@P &F0 c ` pA-P`0@p <4<("4!<0<4<("4!<0<4<("4!<0 h b ` , 0ahl x0d 00 pt A-P`0s0  0 ("#$0,$,!$#  `<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!< 0<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!< 0<4<("4!<$0<4<("4!<(0<4<("4!<,0<4<("4!<00<4<("4!<40<4<("4!<80<4<("4!<<0P<4<("4!<@0t<4<("4!LUd0 cPa p}T@T t0  @nT*Q ldgh(Lx@-`@pP ``<4<("4!<0`<4<("4!<,$,08#$%,0 (P\0 0 b$000PS ` 0`0 00P\0, @-p@` DpP <4<("4!<0 <4<("4!<0<4<("4!<0 <4<("4!<0 <4<("4!<0 <4<("4!<0 <4<("4!<0<4<("4!<0 b `@-Pp@ XD@`  ND0 c ` p@-P`@ @ 4D0 c ` p@-p@` !DDp P <4<("4!<0 <4<("4!<0<4<("4!<0 <4<("4!<0 <4<("4!<0 <4<("4!<0 <4<("4!<0<4<("4!<0 b `G- p @0P$`$ @ ,$,8#$$, <4<("4!<0 b ` ,0 0l 1h00p  0 G-P M0,#̑d  U`rd0 0U" li0@X0H eB!0$00$0X(TO4XlP0 Rl p< <4<("4!l  @ 0(Q<4<"4 Vpf 0S rdP R<4<("4!,0 Sɠ8 8 a(   0 S  Ѝ-0,$,!$# `A-P@M\p0  0L("#E0,$,!$# `h<4<("4!l`<4<("4!\P<4<("4!<0<4<("4!< 0<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!< 0<4<("4!$<4<("4!̃(<4<("4!<,0<4<("4!<00<4<("4!<40<4<("4!<80<4<("4!<<0,$,8#$!,@ 0   0Ѝ@-@PM\`0  0L("#0,$,!$#| `h @<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!< 0<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!< 0<4<("4!<$0<4<("4!<(0<4<("4!<,0<4<("4!<00<4<("4!<40<4<("4!<80<4<("4!<<0,$,8#$!,@ 0  (@$0@4Ѝ0@-@P0,$,!$# K`0<4<("4!<S0 ,0 0,0-0,$,!$# (<4<("4!<0<4<("4!<0<4<("4!<0<4<("4!< 0<4<("4!<0`0@-@T 0Ps !0S0@1so00訢l0@-P @0000C ST 0bS 0Q.SQ@ Q 0S:S :S00q0f0 G-p,cP; $A00IgPP3 =c`P @00@P fP0S  g0@ @P fP0S (0 00(0 gPP0S 8fP $ wf03,l0A-Y@`M;c P<*(0ꬎЍp0@-P0@SP' 8#8#$(,"( 0 x pP`\ 8#8#$(,H"( 0 4 0h$`s0@-0L LLPM0D0 005@P 긒Ѝ0-808 80  0LA P@-@9P PPPA-pP`4M p d0   0P,#@5peP h 0pppP 0S 4Ѝ0@-@ Mv'PP 00 0u@P'( 0'0 0Ѝ0@-@?0 c ` -0,$,!$#,R E-`0x@MHh0 PP0@pS0, @0S S000SP00 < @0W@P a Ѝ@-0\ ,@ 0S( (0R , ,0R%0% S R^\\ 000 0<uu0@-@8 P00#S  S8  D0S dDP80@ 0 80@ 0@V080DP$@0H 0 H @00$@-P<`p@T  0 h0$ RD0 0<Q 4 @0R 80 080$@TT80080@P0@T `0S`4@T茇ii<p@-P @`00`h 000?_C?<0$80KP0'P <<($ /_p@H-<0CS~(G-YMh@D0  `8(P$ 0S P$@ D 0 0S   D 000S   D 0#10S   00), 0JS+p0 %@T0 0222   00 0)`@00 0) P2`A 00,`00 000| 0 \PC/00( \ hf@$@Z@0S%0S@ R Z00|0@@H@T0 1)00)+ "20   00 0)$0  g pYߍ@-L@ V(P $T}000S G-M`0 0d!0p MH 780 x0S<&P$M   0PPPP,@P0 dntot t kt ]t@ @0S*|0S& ~ 0 Q 0 Dx0S 4$0  p @l<0S @ЍE-@Pp M`唀80    P$p 000@P0 H00H0 Ѝ0@-@PYPP0%0P 0@0@-p@P80`P l~$ 7P(P 0S S80@ 04 80 KA-0VM pP`0^@ 00^0 00 00|0\C/00( \ d@$@00 PP 0$@HVߍ@-08 @$ 80080 D @-P QQ $0@-@HP6  \ H0  <l^0@;QQ 0@'pDG- M00), +>p2   00 0)PQPPV%'`P @0^ 00]  0 00|  0 \PC?(0\ 0:d@$@ PP%'00)+."20   00 0)@Hl Ѝp@-@6H` $ Q0 $ J!P0 &A0S Q Q0 T1L.H'p@o%p@]%ph -Q ꔠ  $ $ 8-0  - 0T G-p`WVM"0 V 0,$,!$# 0W20@\ 0)0!0S0!C)A]K0Ÿ00 0bS1"PU< 00 S33 S0W 0S   0R  R" Q 00 P1 t1@R u,0 - H0\ 0H0 )  ) AN]KlPUVZ 0 k`$PPO `\ LDL8#D"L$,$80$Ġ @@c 0#00L00崓@0 D]-0 X 0@S 0 u,0 p(L@RDHTp|- 0H0p0\ @Dp 0L 0@SP0<08 0)0!00!)A\KꄳDLЍG-MA0 0("#L0 )  R C)A\KX (X 00bS6030]-0 X 0- a(L@B_pXaⵀ;X1 !pXa@PP* 0   00P! 00 0- - 0)0!00!) Aq\Kp@Rtث8 0)0!00!) A[\KЍ@-@T0  HwQ 4X 00bS030]=00X0p@R@-@$0  [H00CH0p E-X!M0` DL@!)QC )A \K0p :0 APT 0\0@T0S80)000)A[K R( 0 |0APT 0 PH 80\00@T0Sp$LHHdЍG-d!0 T LL QU 80080PU Rڔ 1 ` PpU+ H0S80 0\ 0bS`0 00@T 0S 0@0 03"00C0PU R08 @S0ڻ- ]-0 0 pH@RDG-` RL@\ 2  )  )AN[Krn|0h0`0a00),0P"2"20   00) & "0 Q!0S 00?00 !1110pġG0AS 00)00) R*@00cS00 1 q) Qq0 8a, !0 0("# @ 0T1R 0 T+0S 0S0S`0 \0R L0 R \0S, 00PLs+G%lxpp@RthX0@-`p )  R C )AZKp@1@@ T ;R  ` *PP, H4`P B4`P 00S00@*`P  0 )  R C)ABZK* 0)0!00!)A>ZK\lh`ȥx@-P1 )  R C)AZK$ pR 0BS04a0`>P 00S0$3! P0 PdL@P0S !P00)"20   00) 0)0!00!)AYK\hl$HP20@-@Ph0  X p1S < R h1U*0p1hQ @0pp1S  0p1(0Q Q 0QG-p M 0 D T0XQ@@Ġ`V4 HP0 ,t (0%@@t1S , 0R( (0R , ,0R%0% S RP 0S00p@x`V ЍA-@tqH` !0P aX q1S 0 U0%0t $l0q10 Fhr1S F0s10PS S00 0S S00dP Ag p@-`pP0 )  R C)AXKP U@d!80080UV d1VT0 )  )AXKG-p`$M 0"0 ,0DT0 X00 0Q0@ 0)0!0S0!C)AXK P$  P0,  0P0j@P) kU` 60)000) ApXK @f #T YT T Td1x\1u0S 0)000) AMXK!dUH0 n 0DLT @J00PPp p < 4 < 4,021r": 2" 0\80@-H00PS D@ 0P !20C2b0S08-1hQ@-@Q, 0 03Q F\  p@-`P@<0 0 3R \ pPPpP 0 0 3R D\ pPpp@-P `P$%@P p\P.& p0, 0020 0A10  0@0px0@-<0"0PP05Q7U 0000000 R 0S @W00%00S P0-7aP ><2B?.0208.B 0     0 00贶@-@0S000S 0S $   0 0C0@a@-`PpM C, 000\0P0  @T  P0< 0@S  ЍA-P`@MpC 0p@P 0S"0S0S 0000S "0S  0p]0S Ѝ@-S@$M^  0   0    0@00@$Ѝ@-S@$M^  0   0 00@0   0@Q$Ѝ-M 0 0$  0@0P0 : gЍ@- @ $- 0 0 @-@P DA-Pp@R 5 PP 0`00)0  0 000)P 0SX" P p< 00)0  B0 0Q000)Q ~ @00PP 00 00)0  B0 0Q000)Q [FP- 0SQ Q Q 00 70hLE-\Pp M 0` R @ Hs0S 0EUSUU UW#@P<R0PP@u`l2 Ѝ@-M 0@P0 @P <02 T0570ЍA-@`pPMP> 00pP4 @`P, @P" 0P  0  003SQ   0  003Sp##0S Ѝp@-P`M q@P P P0  _#Ѝp0@-PM V@P 0(M#Ѝ0A-pMC`P> 00i@P7 220 PP00 P&@P <02 P057W P 0P 0#NЍp@-P`M @P P oP  0 "Ѝp@-`pM@P P 0P 0d"Ѝ@-`pM@P P 0P 0F"ЍE-P@MĀȠp`P! X0  0 0 0  (@ P @ 0 @0 P$Pu"Ѝ-MЍA-pPM`a@P%  0 P P00 `P0  0  @000X0P0S 0 P:"Ѝ-MЍA-@`M p&PP T 0 00"ЍA-@`M pPP T 0 04!Ѝ0@-PM @P 0,!Ѝ0G-@AMD$p `  0 0 3R  hA`V[PPV 00 QOQ 0⁑0  PD @ 0q `P4@h00T/ T pP&  00 0 0 3R  *APp 0   @0 0 $0W  D X  e!AߍG-P@M⬀ 0, 0 0`03Q @`VS EpPN 0 0 QGQ 0 0 P< P0 00㐐 R0 0&`0 @0  0PU PY 0 P  00 P 00j0 Q P0X  { Ѝ-0 0S 8@-@@T Mj1, 0 03Q s@\ W TQt,4H\h > 7; 8N6 ]3 0 - 0) 0'% @@ 0W @@ Q  m  긶 Ѝ- Q0! GhuQ0 1u@-$@0S 0S̶-<(8&40| R&f'u@-Pp@88 `DTdP00P贶0@-@TP0 0)00S0C )A>K1\ 0Q0S 0Q00P0)000)A>K0x0@-@TP0 0)00S0C )A>K1P 0S00 )  ) Av>K00S0)000)Ae>K0xE-PTpA`TM$  0@P@T0xЍE-PTpA`TM$  0@P@T0xЍE-PTpA`TM$  0@ P@T0xЍ0| RE-p M<`@V 0 P 0 3RPU,P^P0JS!!X!`!`!h!p!x!!!!!"@""4%"4%4%4%4%4%4%4%4%"($$^ X1: 0 <0 R  }P.P[R{P3 ^010!0 S;3l03 ^010!0S<402SXwPvPzP^ X1: 0 <0 R+ Vq 0 0 3R  X>^ 0Sx0 0x0 |P"PX1: 0 <0 RUPJ V` 0 0 3R  )>P 00)0  0 000)< P 00)  B 000)00)0  B0 0Q000)Q n0S  PK400GVC 0 P 0 3R  =^2 -”\$ PR01  )`00n`0   )00)  B Q000)Q [  ЍE- p`<0M$P 0 3R0 @^s0GS]&@&P&d& &(&0&8&H&&&&&&<'&'&&&&}0523{01l0/40-.0+w0)< 7 > R 0}?00,v0z01x00  |0  000 00"0 0 T @ 0ό 0 3R  [Z @ 0 0 3R 8<P  0  003S@Q Ѝp@-40`P@P U ;bp@-@2S ”\# 01  )`00n`0   )00)  B Q000)Q 02`Q 0@%@- :M  0tЍ-x 00)P  nP 000) - x00)@  l@ 000)R@-@P l0RP x00)P P 000) @0)R@-@@ 40RP x00)@ @ 000) @x)0@-@P0`Q00)`  ` 000) "P 00)`  e` 000)00@-P@800)`  d` 000)0 P 4 @0 R Cp@-@M  0 7080 0) 0S00000)P`1S 0S00P l0R: 00)0 S  0S000)ЍpG-`@|p 00c\!:PV  0Ph0 P " 0Z700$S 0@-@0S# 2S 0   pR  RP`00C0 ```0 0S00C0mt 000\ 0000C0\ 0S SS P0 P 0 0m$ 0000 000C0m@-PP D@`p00) R 0 0C0@ ppp000)P  )p00Cp0p R  000)R P0S@0St0S @ (l"  0|"xR?t2@A@R /@- 2Au^^^^^^^^^^-Q Q ` 0lR \0 S X1 0 0 <0 R^^-t0S8䒨0@-@t0PU8㉨0@-@t0S8}0@-@t0PUP l0S8l: l P0 R C R:y0-P@-@D T0 D  0T00 00?l0h00C|| P4  (0) l "<  8 @8 888802 2"„x1111h2-0M\ \X|Ѝ-0M\ \HЍ-<0<.404*,0,&$0$! $ L@-`\!\0P 0S  l\D0D pRL0.0c\{:x< jRR(0So\P0Sh Ze800) 0S00000) D0@S0ST00)0 S  0S  )D0S  00)D RP 00)p  p 000)00 0)00) R 0 0C0p 000)Py 0 Ѝ-00)p  Bp pQ000)Q g@-0, @ 003Q  4^ - 0@-@8RQ @1PS 0R P0D,DPA Q0PSS0( (RPQ0 l P0 R C R_#*"0700@-P p0 0C#ATT\  >P 00 10` R^\P!R 0R057P 0000^00p@- PU 0@SJ`n@TZp@-p`0@ S`nP Qz0 0c0St\V0S S k PPfJQc 0, \0P X16 0 <0 R1 \1 P 0 P 0 P X10 0 <0 R 1 P 0 P 0 P X1@0 0 <0 R PPU0 000 B bR``V P PU P<0PP T 0S ` E-P M` @V  P0003P*0@00 |p@ 0  0 3R  t3\ D 0  0 3R( e3\ 00 @ 0 0 d0 ЍG-PM0 p 0C# @Q`  0  003SPPQ @ !0@00 1 1YNPPY< 1 @U` , 003Q00PU , 003Q00PU , 0 03Q@ PU @0 0 d0 0Y000Ѝ0@-@P  PP +00SJ !0\00Z0 q 00&q$00&|0R:0R1G- P @ T`@M \p1 Rh$S,StSSPQdSTSSSSSPSSSSSSSPQlSSSSSSPQSSRSSSPQSSdRSSSPQSSRSSS QQSSSSSSPQSSRSSSDQQSSRSSS 0 0Š0à<Š0<àl0@0\0\*0\ 0  \ \*\  0@x0@u0S0Qq qXPk 0,$,!$#̂`0S RQ\ qCPV HQ7M:Q q5PDBP@000Q7*00Q0.P, 0( 0Q$ P" "  0 0Q P P P '"48<#Ƞg04@ Tx@Ѝ@-^@(A! 0 S0 S0S :000S000S0S0SSaS`S@^!0R0SA-P0S0`q  S h@P p 0 0 3R  1^  u 00  PP2B@T! 01  )`00l`0   )00)  B Q000)Q  0 S88 000#3 <0Ը`v0 S\ 0X0C0#3H <00S Q000S kԸ`v0@-<0@PT 3P0(@T0d ,0 R 40S( Rd p@-`P0@ XT 5Sho y3Pp(@Tpd p@-P`@ 5Pp@cTpp@-P`@Ph00p000S0Kp0@-P5 40@T   @T0ܸ@-@P, X18 0<0Q _@-@0`SXϭ00)p  Bp pQ00 0)Q 1(p@-P5` p0S `V0S\005A05:<0@T   @TptYܸp@-P51 \ 0`S L@000r0S0S 0S dh5P A08@#85T   @Tpظ0ܸL0S 0Q0 R 0Q00ܸ<0S R000Sܸ@-p`I0P 0 R$0:0R:P   0S 50 0 0g0  PU 0S S 0R @PԸT@-@P  0\ aR$0b \0 0g0( 0Ci0R Ѭxp@-@!0P00@0`S $0S @P 0S 00@00C0p5 0 R yP0P p咬00C0  )p00Cp0p R  000)R pm0@- P0@S5 00)P'  0S00C0 00 0)  )p00Cp0p R  000)R P00 0) 0 0@-@0SW!0PCP7 1 R0 0) @00@000) D@-<00)  000)  )p00Cp0p R  000)R. @c 5  0S0 0000)  000)  )p00Cp0p R  000)R 7de(wG-2"Q 2 R "00iS00)h PR P0 0C00 000000) $|0  Q:Q0'儫  )p00Cp0p R  000)RV S`1w@匁T  R 0R V P  `@T'3<0@T 0S R 0R V P  `@TV    )p00Cp0p R  000)R 0 Si0 0S 0 00$ G,@RԸ`vde R0@- @l` M 0 p 0 3R  -\ P P[/ 0 0 3R ,\  ЍG- M 0 0 3R  y-^ 5pD0@PU 0`1S T d  gPp`V(PU p 0 0 3R  c,\  Ѝp@-PdPT0( Q0 T0 QT0( Q0 T0 Q@-@0 0 $ bR00@ 0 $ bR* @l00@RE-P\!0pS d00EƏꀠ00!0cS @p $@T 10`@T.  ' 0AS00,P R 0  bR 0000C0 0 0 $ bR00q`@T Rl0 00Ew@R0u0@-@10@L 0 $ bR*000@XP0 0  0 080PK  0004PT0 0 S4 R 0 0C00P4 000Q@00) R 0 0C0P @@@000)P"  )p00Cp0p R  000)R Z0@0H0404T Q0000@R@-$2@ P p Rz0S90SU 00)p  Bp pQ000)Q 00C08 0SU 000 P00 0 @0H0寎T 0000S.U 4 ,0`P:80@00000 00)p  Bp pQ000)Q 0004 `DP4PS 000 0(@ 0H0i00C0m@RG-@P M,0 Q `  @ 8o0S T  p o _$P  R p@500 <"000"0 0  TZ Z @⩎T o  0`V (@T 00)  00)@T0p1 B ZX  R 0SM4@ (0 S 80S  000S 4 R 0 0C00@4 000PP00) R 0 0C0@ PPP000)P  )p00Cp0p R  000)R @R Ѝ0@- PQMo0S 0@P   0Ѝ0A-P("h(@ p@T 0ST- @P(  ````P @00)   000)( 0(@0S T0 T0 T 00)   000)<@p@-@M 0 \P0bc \ 0S 7``#$(,"(0PPЍpE-PM(@Tl 8`Vi \0 a0b\00t!0SPO p0S <Z(000<0SL0 Y 0\.$(,"(00C0@000 0 \.$(,"(00C0PT0-00)p  Bp pQ000)@RmT 8 Xo00)p  Bp pQ00 0)Q Ѝp@-P@M (0`8`\0 0a\0  \ 00 0 !$(, "(0P0C0T0m00)p  Bp pQ000)Q ЍpG-p` @ 1T4 0@ jR#00C00000 0PS   )p00Cp0p R  000)R WR00W0SpPT@ᇌW 000@RE-p@1P`)@x, D0@R00)p  Bp pQ000)Q+ Eꔀ00U P 00fS@(00P 00)  B 000)0(00P  P埋@Rp@-`LP-@P  L _PV$ 0S P p 00 @pQ@- Q 0S @T00@ 0SAp@-@08`0D| PPPl0@ D 000IP 0PP0@ 00P, D01|`a@`p@Rx@-HA0`00⽋⻋Pp@00) R 0 0C0P @@@000)P  )p00Cp0p R  000)R P 0R0C0 LϛH 0 S 0S00 0Sm @-@M` P \PN J 1PE q 0PS<Q 0 0R 6 0\ 000 0/@P  0P<P  ),00C,0, R  000)R 0S00C0꘶mPbЍG-Mp P P w 0UPhn1PUi 0`SaQ 0 0R [ 0Y  R o0 0R !000 0@P 0 `` 0 `  0@P`h`V ` 0Q<`T  ),00C,0, R  000)R 0S| 00C0꘶mPUbЍG-@P1M` fP[ R\0p 0\0@!g3p 0T0   0 0 04    B00R2 X0~00S 0o 0C  S  0l0  C0R 0c0 b 0, 0c0  0W00f0\ @R \0bS0\0ЍG-`M   P儐p0Z%0p00 0 APT HU8 0hP000Pm@PT00C0ZP0\ЍE-`Px0p@0T VX 0S V g  P@`T`\蘶A-`EPp@PhE.V800 0408  d00 ( 0 0 , 1D0@!< l1@0!H 1! 024 ,"(L0P 2T0H"X t2"Hs0/.\#:.⠃ $303?3YP @hP@-@T 00mp@-@P`  )000   )00  )00C0   ) 0S H{<x0S 0 0P0 0Sp wPv$w-'x00)  B 000) R840 RL0SPv$w w0w@-@Pp` Uڰ0SS R00R0S1@000Pc@Uڰ0SSA-P `@p\ 0 P\   ᲀpA꼬A-@PpSMD 00)p  p 000) 8`0W  @0c0wЍE-P`Mp gP R\0 @ 0\04"i 㴠@ 0X00 05 0400$0 0@DqTmk 0|o0S 0 B0R[ h0lo B00RN `0_ 0CT S B 0S4 80R  0CS4 80E0S  @D&T"0 00-@0S P  0C_S \ 000g0\ ܭ\0 aS0\ 0ЍA-`P0M@pd `(@T V 80   5P`\ЍG-p@XT00T 0SAa R Q0 R T? 00P 0CS@T@\vp@-`PM@P)  P0 P00)p  Bp pQ000)Q   0DH0wЍp-0H   0   t00)  B 000) R <D40 R L0S  w$w0wG-8@M00)  000)#00 00)0  B 000) 0SD00) ` R `0 0C00 000000)VO PPR:00S0!00  Q/QAP  R `0 01!R 1@ RAq H0 0 0RJ< SG 0S`!0 @0S H0     )!000   )10 0P H0  0   ) 00C0   ) 0\0Q!Q 0a\0 jR <0S 0,dP0 0S 0V wPvv0wd02 0Q<: 0 bPڲ0SSd R 0R)1@04000cPڰ0SS0S"0 @0S  X@  0 @ X  00R R- 0 \0 R 0a \0 \ R0S) \0S 00)0 00``000).0  )p00Cp0p R  000)R s  )p00Cp0p R  000)R _ @ vPv$w00)d0  B 000)D R8㕆00 R L0S  w$w0w@ЍQ--@展<=40P(幓$W 00D0` 0w v,12c``0  ᬾ@R 00#0ꬾ@-0 00 c|000Sd0 0R :T@0c0Q @j00$ 000@R p@-@|0`PP 0S (PU P0S000S000S 000S0 0pd A-@Pp("h|\@P\* V@ &4 0 ` 08#8#$(,"",  X o o h50S o0S VW`o L0@-P 0@$R (o h00@ 0@-@%\0R$0b \0 $P0 ` P00h P 0g0  4 S0 Q  0@-@ $0p@-`P0 @ S  0#4 0o ho {ppo0 r@-P`@ p$R  @c" "PE^"1"#$(,"( BR00R0S 00`i0@-D0M@7Q 0\ 0  077Ѝ -P0 !0 d P-  p@-@P`P d0 R P40 X p0$p(p@R@-h`PpU ,@$0SPP0S00`PU@-d0dPdp@`T ,$0S 0X T0bS@T0}?0@@R-00)p  Bp pQ000)Q *@-@(P 0X娓00)p  Bp pQ000)Q   -l  0 01d00^  00 (00(0<00<0  )p00Cp0p R  000)R 1 @-d @ R 0 0C0 @@@P (00C(0 \-l0L0 !d 000(00(01 A-dp P0A`00) R 0 0C0@ PPP000)P  )p00Cp0p R  000)R j R0(0 d0 0SZ@-`0pdP@PU - 0P0 0P`00 0,p0 ,0S P @-0@000000S 00C0mp@-@P00)  B Q000)Q0 0,`Q 0S S 0 0  0S S00  m00000S 40S 00C0 pmp@-@0 R0S rPp@P000  p `Q }?T0\PX@0T 0bX0P0}?0O00C0p@HD m@R0@-@000|PPb0S d Q Q000  Q Q00 00C00m@ 00 @0@-PP0@00@000A0S $$0000C00m@` 0@-@PT P0@T0SL0  $0S40$ $ 0S0 00P0DQ QQ 00 P 0SP@-p0`VPP @ @-pP d0@T P<`0 RP `V@TA-P0`@T  P DTV 0S 0S 0pC W 404D@P 04  0 4@褶 P40CS44P(0P 40WPᤶ @-pLPH`08s010]P @DTT@-@5P h 000`pV 0S#80UPP0%00C0 mm@E-pPQ0@T `P  0 G-` Mp0'PP0S 00CS @ APU= 0SHd@8`P5 SU0T  0 0 0 P00 0,S00  \ P 00,0S P 00`Q 0 0V  Ѝ0@-P@Q 080S P 0S 0@0-0MP <0000   0S'Ѝ@-00@P P  R' @0G-@P M  `pP^ V v &BPS G000S+  R 0S A*P @T 0 P0 R P Z0%SV 0 R  0P 0S  R 0I ЍG-0pM0 &P Z} z *P  PPU 0SPU Q 0Sg Q> U 0 e 2 PP 0lZ 0@T 0` 0 RyP X0U S  P '00)   000)]UM < S lG 0@T 0``0 RBP 000S0QW UPU) 0l M 0@T 0`0 RP X7 0P P 0 & 0PP 0@@@T@ U 0 PaP ЍE-@`P e#PE$ R\0$p $0\0!0"p 002000,0S400 00  0CS 0 0J0<0S P 0C( 'SL $ 00400e0\\0 aS0\ 0G-p`P M,8PPh@ V 0S  0@%@PY   0V̠@$@tP \0S 0 000)p  Bp pQ000)Q e ЍG-p0MP`0 V 0 0ZÜ@PT U 80 $  B.P@PT(`VP\d ЍG-0M00 pP  %HHUP w '88TS T yS@T0@W $(H1(0pT0@`Pc 0Y UwP$(0(0PU \0 48S<(@)T (T *T 0 -P& 0 @} 0(u(0 P 0(\0S  ЍE-@pP e#P=$ R\0$` $0\0 "` 002000,0`S4000 0 00 0CS0 00 (\   0 P00e0\\0 aS0\ 0A-p@`P M8pPPh'  0$@@P00)p  Bp pQ000)Q 0 0 Ѝ@-@ M080 (  d ЍG-PM 0#S5"P1 `@pT* V#0 R 0S #8 8SV  `0 P 0 0 0 S @`T`\|ЍA-@Pp<0<< 0`ePP@0@0 - 290^ 0 00  p 0h0  0P-L+@ D8000v@B @-P d0@R  00 @@P0\0 0P0  80080\ <0R0<0 P 00)p  Bp pQ000)Q (  000  P0\ 0P0 R 0 0C00 000\ P0\ 0bP0 - 0S\# 00C00000  P \0 cP 00)p  Bp pQ000)Q  p@-` @P00) R 0 0C0@ PPP000)P  )p00Cp0p R  000)R 0P0p@-( d0@R 0 00 @@\ 80080\ <0R0<0 P 00)p  Bp pQ000)Q d  000    R 0 0C00 000 Q  L0R,T0d ,0 d 0S0d0@-@M0d 0lS  0\\0 aS0\ 0ЍG- 0₁X% p j`P@I` 0 cP2 00 20 0j@ @` CbT ?0#5 0X  @0: 0G~yꨶ@R@-P`0p0CS0S>:@Ph8 $ 0`00  0P2 0  0` 5 !00S00 0 01 L0110 0 3y00A訶@RlG-P㈐` 01 @p P 0 S@00?`PV 0 0RyPU輶@-pP d0@T P`0 RP `V@T80@-L @PT kP0 @T00P088  0S SS 008G-0@M00   #xx@!W 0#48S(A0*P \  !P  00 00S0 ,3  P P PU 0S:W 0 S\PUL 0RS 0d"48SgJ$PP 0B@P`V 00CS (@ ᜭ/@T $g  @0W  1R00C0  00P 0 48S7#0-S ,S .S 0 ( 0,  0 ,y, 0 @ $(P  $0,_Q   @ЍE-@`P e#P@$ R\0$p $0\0! 2p 0002000 ,04p  0 #88000  CR 0 0" 04\   0 P00e0\\0 aS0\ 0LA-p@`P M8pPPh'  0$@@P00)p  Bp pQ000)Q h0 0 Ѝ@-@ M080 ,  a ЍG-`0M p0 #S| tPw 0 Q㘐 !"Yl 00S 0_ 0 S PS  0 PL @TF X@ !((R 0R7("(R 0R0 X PU80 ,  P00 00 R (p,`| 00 0 B$ 00 0R00@T0S  \,0Ѝ00P $0$ 000 v`t@-0| 01 Q @T0800P 4P @f 0S X@@ A- M 0 0CPP@QP "0P 0S P@T 000z\@Pt \<00 R P0_ (0S  wP4V 0S00 0S00 00 0 R 0 00R <204 R 0 31$0( 0`Sp00S00!R 0S0 R0S000X 0 8#001  @ @@R<0P QЍG-P8M\ 00 @0R0@0 L0S6*\pW10`V1 04 (0&0c S@1 @!Q 0 >03$! P b b 0 73@0 T@` @`0J(0 @0$0@RH0 0H0Ѝp@-P@,M 00^  0` 0 _4P  0 U 0C/S , 00S 0CS 00S 0CS 0\\0 aS0\ 0,Ѝp(0  R 0S@-@0`pPP \0 Q0 0 0 A\ 00  P00)p  Bp pQ000)Q A-P`M0\p\|0C0S*P 2 0@000\0C00Ѝ;00@-@PP P 00,0,, @P0 000 @-T @@00) P 0S0 0 000)0@-40@P@T  X P00p@-@`PP \0 Q0 0 0 A\ 00x 0S<0p P00)p  Bp pQ000)Q Sp8p@-@P`\0\|0C0S*4  0 p4- \0P 䱄4 p@-@`P YPP @ < @`400! $ !00Pp4dD 0@-pd`PP00)`@T  P0 0Q000)0@-M\000@ Ѝ - P0 !0 (L P- &0 P 0 p0@lS0 !h 0S0c233h0-Q 000000Sl02 1   \ \ \   @-@ h0Q  00$0ss@R@-@d0  փ00)   000)d 10S#@0 #,<4<!4# < ",$" @<4<("4!<# "!$" !,,0@0d00@ P#80  ,<4<!4# < ",$" 8<4<("4!<# "!$"   0 0< <4<("4!<# "!$"  0 0d ,d  @wp@-d0L  0 0 00 0 0)00C0   )d0?#80$48< 8#809 :0ax\`00)`  ` 000)tЍp@-`M\P 0\0` Rl89 C:0;$Ġ Ƞ̌s<=@>P?`,Ƞ'Ġ Ƞ̌,Ƞ @P`(x $00)`  B` 000)Ѝ\G-M$ p, R40(0 8PŸ@4 pတp000$ 1\"`0 0V 8,0倐YpӒڰ0L1S; 2$2$2$2$22$2$2$2$2$2$2$2$2$2$21$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$2$22$2$22     R   TA1A#8P<"48<#8,$,08#$ ,,48 <#8 .$(,"(0 D00$ 4 0<4<,4$@%< d 4 0 (0pW 00C0lm@wl x@R` Vc$00$0$ 0R0C0N, ( 0b0c4 pc00 W0Ѝ0 Q  R,0  R0 P 000@- @0S嬛PA-@@P`pMP  000 0Ѝ@-@p@P`P 0 pA-P@JTp`JM4 0 0 3R  \0S S     P0EJS* 0 0 3R  P PJߍ00S j00Sj@-0@ R$nP  v-y@-t@tt000   0 00P@0@j40,@wpu\8!("(-P 8 " 0  00)0!0000 0) Dv@-@P;v Q 4v 0 " 00)!1 Q 0T00  ) 0S000) 0B1S;|99999t99999999999l9999999999999999999999999999999999Q44y((0$ u@!!48<# 0!4 0!R 0Q R0@-@PP 0PPn T0S uT0TP0S 00)  RZ000) 0B1S;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;QDD8804 +u 000)00@-@TPUh 0S 0T000)  RRZ000) 0B1S;==================================================QDDm8804 t 000)U0蔷@-@`TpP\ 0#0R<4<("4!\.d0  D 0S D00eS0ұ0ҡ0,$,!$#, d0  L R<4<("4!, L00bS0ܱ0ܡ0c,$,!$#, \  0 P 3Sd0D   D00eS0000d DP,d @-@`TpP\ 0#0R<4<("4!\.d0  L 0S L00eS0ұ0ҡ0,$,!$#, d0  D R<4<("4!, D00bS0ܱ0ܡ0c,$,!$#, \  0 P 3Sd0L   L00eS0000d LP+d G-@P'X MTT!P(`pD!ATb (`V\ 0L1S;BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB     R  0 $,p0l0   P U@TpW0h@cPd U  00H Ѝ -G-P$x P `h p`V  \0  b* @ $|0\ 00e\0 @P)s0 0 0 \0 \0R 0\0,! Ώ0 c 000  $00$0g g 77i0i0(P 00)   000)(   \0  b00)p  Bp pQ00 0)Q AdDp@-@MPcPnU`\!  0 0@0 0 0 0 0@088"0#8 ("(0"48<#80Ѝp0@-P@T00S00XP 000-P00)\0S P0000)0S00)00) 00)@-@PDLr0S $ 00@=r0@-@P3r0 Q ,r00000S TrDP0S T 0PSr0Lp@- \0`@PT $0S  P rR @Tpp@- \0`@PT 00S  P rR @Tp@-pL0`@P T ,0S  P@T @-pL0`@P T 80S  P@T @-p`0`@P T (0S  P |\ @T @-p`0`@P T 40S  P |\ @T 0@-PP0@T 0S 0S P0@T0@-pd0MP`U <0S @P ,0T 0T BPU 0 01 0Ѝ@-pd0MP`U @0S @P ,0T 0T PU 0 01 0ЍA-`P0p(M'0|0P  @8 \q0P  (ЍP- 00 pP-`pQ Hp00, 0P  0SL@-p`T0@ XT 0S0S P @Tp@-`P0@ XT 0S 0S P @Tp@-0@ M0 0꼷 Ѝ @-@ Ġ0S .S00S 10A 0S.S0 R R  8 #, G-p`PUM840@@ p8 000( ATC `Vp;$m< 0Sd X P00  00 \00  $00( x0$0<0 S ( < R 0R   , |0 00 0p< 4 p0V@TXe804 Q B 08 0a0]mЍG-pll1l`d!0@00! P D!P0> 0S 0lS)%0S 0 0 cR P0  p0S 0SQ0 R P0 \  R00S@P 00 R0Sp6P0Sp2W$ 0 00Gv^@Rз \E- 000pPဠ1P` 00C0@0pS0S:T000Q00C0mDA-0 0 `V``PPp0P00@^P Uڬ00S gV 00`\ U PU00C0AL0S@ 00000^00C0mm@R HDG-ßM 0 0cS*2 Q2 2DAT2 R5" @bTڤ?0 S0<@c0?0S@Ld"0d00@ 0cS%T0000 000"p p1P`PD 0S0)0S 0 0cS0ڄ1 0 cR P0 p0S 0SQ0 R P0 \  R00SP` 00 00R0SK@DPTXڼp0TC-0S 00p0 0R1| 00S<0S 40 0R"P 8n@RԷ$<ܷmطm<0 400S 0R*$ЍG-pŸpp2p M Z4000 1 P @`TG phh P<00 @  )000  ))000  )00x0X0C0  )00C0   )0S0Sa @PP@TT0S p0S<]dP8 J0R0C0 ڰP@p`00`pX 00)  B 000)0S0S_$P Pmhmm@R<$00 00C00m Ѝ@- 000P@ 00)  B 000)\0 ! 0S S00 R0S00C0mG-4M0,0000(0X0,@40$ $0T0T00 X <0S 3 PR 0S Q 3 PR0S 0S S  0S$0S hlP 0S 0S X0P}P  2Ÿ0 0q  0 " 0,"2#0" #"(""4"|"`AT h0 Sl 0Rx0S t 0Rp0SX0 S\0S4PUd0 S 0X ST  )000   ) P T  )00C0   )z = D000P0T8P00C00mp@-hv`P`00X0`T@0000WR404IW( s[ 000p\Q @Ru(l0G-Mp4pD@< 80\ll#@p`#0倠00DPU <QG(0 SDATA `(0S70倠Z32,Ÿ#$(,"(!48<#8 0 00 ``0 0 0b0 2S 0H4 0$(`,`H @<{pW40@0T40倠 Z\ 0S: U1V 0(P  )000   )( 0  0@`T0 gg0 ''0 '0'("(0"48<#808  8 %00)p  Bp pQ000)Q ᔥ tОP4 ,  0\<00<0tЍG-3#M 40 \ P040ں  X#0 0#0#?0A@T 0S 0S0 S 0SK0T#$(,"xJyy0q0a W   aW  P "48<#Q f P  0U PPU 0S  Q 0Wgp  @UQ 0`SM0 c aR 0 0 0 9 R 0000 R00 Px  )00a0  ))p00Cp0p R  00 0)R ɤ  )00C0   )Ꮴ@V 0`S 0\`P+  PR ``U` wP { 5,0, J,t@RP |  0[00) 0p  Bp pQ000)Q o<0Z0<0tЍ 0 0S S S EY4=NG- ,M50S P  g0Sj P(`PH0S\0 X d0RL0#0lP0 r 0S@0 BR :f0 S 0  R R P00)p  Bp pQ000)Q P1 P,!48<4#08#!$(0,0C0"( \0S0@:0@$ 0S 00!0B RSSPP0u  0@弝X x X  :0 X P0 /P0, P  0@՝Xx <1   QL@(\ 0R  8 `gP Z 00000@00   Z , X1  0<0 QV QG @. 01? B8c02c2c@ 1"`La<4<("4!<0 0#"R1 Z0i0! 0 020   W*0S0S0i 0Z , X1  0<0 Q gP RPE.MbPPZ  0i0RЍ0@-P0S 00 C@C S B; 70  @00C0  B0S 0 @C@ 00C0@00S00C00 00C0@v0A-@ `pŞPP 8  eT W , 0 03Q \   0  @0T@00 P  ⹟PG-M,0(  0p @00004 0 p@0DPP@T`VX PV D0 000 X0 0 \U0 0 p  @q0000 000  ЍG-@,M0(P Pg g RT0S0]  0S  0 00QN` VD0Fp0 S 7(P0(0 0cP(T00CSP  )00C0   )(P U  )00C0   )T0S  p`0 V00 V000ЍA-PM p(`W 0 | l\0R 0\0*! ᫝ 0|\ 0CS 0\ *!㞝0@E00H"E0C0 X"R R0Q 0@00D20X  \0 0" W%$"48<#80  48<#8 0 @ \ 0 ,00R 0 Gp P 0P00)p  Bp pQ000)Q" H 0 0A0 0 0 0 0A088"0#80(0DЍp@-@(0 `, X1: 0<0Q 0 0FSS+ 0 0 3R  P  j`, X1: 0<0QV [tЍE-@PpQHMd`^C 0  0 3R ^0E!S |,8P00)0  0 000) P Q   m00)0  B0 0Q000)Q ᤏ0S  0  003S0 0 X1! 000 3RP  0  003SojL2 L20L2#1L21L2#200bH20_D20\T20YX20V 00)0  0 000)<0S 0000)0  B0 0Q000)Q 90S/jtW20*U20'V20$ X1 #  0  003SQ<\2`"0 0  0 3R P H[F H0?R0S Q   000 3RP - 0  003S P X1#   000 3RP 0  003S p\ HЍ4M \ (0S ( 0S2 0@-@P }0S kGD D0S\T }0S \G0Pl<0aS\  RJP 0 0 PE\T }0S =G0T l x 0@-@M00)0  0 000) P00)0  B0 0Q000)Q JUAЍ0p@-@P8`UQ (0 Sp@1( S0 0S2"  \ 1S0\v0S$1SA l P0 R C?RA#*"070$1  p0@-@t0PU87: l P0 R CP0?R:㓅0p@-@d1`Q  0CQ6 BD1Q' >(0 Sp00)0  0 000)P00)0  B0 0Q000)Q ᶍ$1PS !0RPP(0 S :l P0RCP<p<0 0003SPpTG-l`@ M`(0 R#t 0p1S >`k( 0S2 w0S ) 1\@ Y0S T00800) 0S00000)  )00C0 R  000)R0P 4( 0S2 1S5 00)0 S  0 S000)  )000  )(0S1Ѝ@-@M0P00)0  B0 0Q000)Q P l0pR00S>"00 7080 0)0S00000) P`: 1S 50S00P l0R 00)0 S  0S000)00)  000)ЍA-l`@M P@0p00)0  B0 0Q000)Q {800) 0S00P000) -500) 0 S  0 S000)  )000   )ЍG-p@0P$M00)0  0 000) (3尀 S1 PP "070<Q 40Q 70S R0@CP 00 0 @Q@J 0 R0 0S1S:0 S XP 0C\@S dP@0R*T   01 b0Q01 :010C01f`0fP@@ 0T@R! 0\ S0 \ !-, 003Q  5\ 0 0\ I 0\ S0 \  !  0` 0 3R  0ZT 0 0 ` 0 R 000S  @00@0 H00H0010CS01 84`0,0c0 @cT T @!`T @0  T@Y 01T  Y 00   03PPr"0@70<0 R@\K `T HRPP!0S/Q#\0S:Q#\0S*T0S `0%0 0CST 0A\ L0S: 0, @00aS?0S^  T0S>0S0P >0<Q 40Q 0S R0@CPU  R  Q00V 00H00I0 0 H0D 0H04 \00\0 0 ` 00P", 0 03Q 00  QT 0 0` 0S40 000<00@0 Qg  R [Z0101Q .> 00c(0S%   -0x1 0 0 R 00)p  Bp pQ000)Q i 0 0^L `T HR@@!0S/Q#\0S:Q#\0S*T0S `P0$0 0CST 0B\ L0S: 0, @00aS?0SPPU  x T0S>0S0P >000)0  B Q000)Q ʼn $Ѝ(0-SE-@P`Mv$Q$1S  Sp1S `iu0Pjd(0S : 0u0[00)0  0 000)$! 9 p 0$! ;$1Q 0$X 0( 00000)0  B0 0Q000)Q ^Z B0p00 00W 00)0  B0 0Q000)Q : Ѝ@-`D D0pS\/ d0S, p0S)@P00C0 PPP0  )p00Cp0p R  000)R GD0S\ d0S p0SWڰP0  0@R@CP P:3!0S$G-00c0J0u0G D00[  0( 0 80 0)0S00000)000)0  0 000) $0"S   GA!00D0D  S@@T 0<0aS 0`a \0`FVM:Y0d0@T 0R1S Y :(0Su0S j$Q  ) 00C0 R  000)R ,"0800080  ) 000  )p  )p00p0   )\0Pfp (0$!SP1R !0 cR *Rv0S`0PE00P0 00, 0#2͋P  )00C0   ) e  (0 0e (0  )00C0  )  10aS$\ 0S3:0 $Y-p 0d0R(00C0 0  )00C0 R  000)R ̉ 0Y00 d :0:(Q R $1S !0R 0S  R 0S,Q 0$`0S 0`( 00) 0 S  0 S000) 0 00)  B Q000)Q *<Ѝ@-@`(0 0p(0\P( \ U 00  R #0PUH 00C 0V (0Sp2S0 LH@-@) ( 0S2$ 00)0  0 000)P i00)0  B0 0Q000)Q E-`p4QU$ ~㜀@(PP "00C0  )00C0   )10C1$ (0ቇU0M/418!DE-pPM00`S K?000)0  0 000)( R0(@ (0 R #@Y0PTx! 00C 000)0  B0 0t0 *SD@0 @0 C b`  )p00Cp0p R  000)R kD R 0 0C00@D 000\V 0(@ (0 R #@0PT 00C 0 P WU l`0 `080 0)0S00000)00)  B Q000)Q  ΅@@(03 Z.0pSW 00)0 S  0 S000)  )000   )(0Sp2Sd0 00)  B Q000)Q Ⴥ0t0HЍE-0`M 080 0)0S00000) Pp0@00  )00C0 R  000)R K.  )000   ) ~P0S 00)0 S  0S000)ЍE-PᰠM00)0  0 000)`(0 SL pK@P `F Cl@P= 0 S8!00$ (`0~w 0R0C0 @0S 00)  000)00)0  B0 0Q000)Q ĄDa00)0  B0 0Q000)Q ᬄЍQE-@PM 0 00S)<0 0003SP \ \ \ "0AS /0S 0Q0/0}/0SxQ 0/0o/000)0  0 000)^`K T HRpp!0S/Q#\0S:Q#\0S*T0S 0' 0 0CST 0B\ L0S: 0, @00aS?0SP I T0S>0S0P >0&00)  B Q000)Q [ЍQ@-`pM@ @ I P<0 0 3RP00U'P#\ \ \ 60 /0S000/0S000[ 0003Q\ 0  003S I\ Ѝ@-w0SQ @0S00)  000)w0S Q ,00)  B 000)E-<@ :xM@@݀h1P\6: P:@@Ѐ@1P4):P (:@@À1P :1qa 0"$S*@RZ4#10ZP@TZP90 E4#!R@ @4@S:Z4#10<P@TZP<9 D !L$!T!d!oЊTԊ!!0  ;!Ѝ- ^P0! 80 P cR 0 R0 0#1 0@R0S0 00bS0lS QQp@-P( 0)0`V V o0 0h01(@( @ R #0PTX 00C 0V01010S +t0 *Sp蠛A-@PBuB T`pPET0@S\,$,8#$ <4<("4!) 0\& \$ < 0bS p0`S@00cS I0 \0S0C\0I00I0X WXp\ 0\ \ < 0bSuG-p`M !A X0S SH PUU@E0CS~p% % & ' P' P' (& U@Et 0q 0#$(,R?"8Q3Ɓ dU@Ea 0^ Y\1 RX @ 0S R,P :00I U@EF0Y  Q R= 000<4<("4!<0<4<("4!<0)U@E& 0# <0Y  Q R 000C0`"\d U@Ep0 R\ 0 !peXl 0 0R00S ?3dЍ0@-P@0QHT P00R0S@ `0S 0aS*1 !X0S0SU,QL0P!PX0dS 0L`0T0TSP 0@a10 R1-X0SL00L000@` R 0bS  j0Sd0L0` 0j0b`X0j0S X0S0Q R0G-`@PM h P @00cSPTp<0  \0S0C\00RX0 PPS0CX0@R00T00CT0 0 0 0c0 00C00000  )p00Cp0p R  000)R T0S^ 0^ ,00cS0Ѝ- 01R ,0@ 0bkD>0S)P D0# R !.00 QA\ A H0Qa #A0H01!0H ?0S T0S H L0!0C23"1D ! ?0X0\0D0H L0!0C23"1 P P0 SP P0S0P0@R.G-P`p M)@``P>0Sa 0x0gS  00cS 0, #2R `:$ 0hSR(00cS( R!48< #8",0R00`, $(pR0 01> RQ 0`0  X0S?0S 0S L d0R6S:060L0060S  0`F2?0S T0S,?0X0\0(& 0$D0 QR A H0Qa #A0H01!0H H L0!0C23"1D P RPP0S0P0T0S  T0T ?R Q  P 0DP 0l R C0S '0`WT V00R0S`0S  j00WV  0<P 8P00p @R.U }0S  8`" Ѝ@-@ @R 0 0 0 Q  R 0 0 0 P % R$0$0$ 00 000@LA-@` P R-< 000bS(400SP 6 0@-!@"48<#X 0 RPE<4<("4!< P bR$1S 10eSP  `  !0R00<$10S0P >0e@RE-`p 0P\g ;s@P0 0 0 0 <00<0@ @ H 0H0 $R040 gH0$ ! 040HI0 \0Q0`\0 wu  0|`\0< S@ 0\p00\ 㖪D0`D0 "@@ 000] -0!43bAP 3ncPӸG-`pM<Q 40Q 0S Q0@C)0P0Sn@0T^ TP0H S! R/Q#\0S:Q#\0S*T0S 0 0 0CST 0B\ L0S: 0, @00aS?0S\! \0 S !P0 R 00p0@ D T0 0T0uQ@00T R $1SP `@RЍ@-`pS40@ 0b?@Q T@QP1t+UhP+40S0CTT eP00P0S 0$,$G-@Mf0PS 0 RQrf0 S 0  R RhH\\` cI0` 0CV[0 SX 00C0 0\0 0\0p 0S0( @t }\ jb 0\0p 0S0 )t `0 .`@0@0H   4 04H00)p  Bp pQ000)Q t 10C1b ЍE-pP<Q 40Q 0S R0@C0PT j00` T0 S@@`T V\0 S R` @0T T@-@pP<Q 40Q `0S Q0@C\0P``S  P T00T0H0\0S* 0R T0R 0R 1 R  0P\Q H0 @0 0CRQ< 0\0`I00I0\ 0 \ f 0RD 0 0R0S tNt@\0 0\0,  , l@R@-@P0Sv1ST0T S00 0R00T`p0 0S0 Svq\ L0R* 0 0S0 S00vqQ I0DP @-p`T0T PR@@ T 0B\ L0S*X0pW*@T 0T T0T I0P @-`pT 0<S@@Q 40Q v0S R0@C0PS8 \0S5*H0@ 0 H0@ 0Q00O/0SL#\0SH*T0SE H0 BP0T Q0@ D T0 0T0st0S*P @.\P0000 0 p@P  00` H0I $0 000<00@0+@R0@-@0 rPP 0 0` H0I $0 0 0  <@0 D00@Rp@-P0 0 o`P) @0 0`@H0I@D0 0 0 0T<00@0 0   D T00T0sp p@RG-P @M`0 opP T0 0 0 0 00)   000)(@0V01(R0()0 $ 0S00A |\0 dR0 \0*T"q``d 00 020 <4<@ ("4!<<0<4<("4!<0DA@X7(0$  o 0@R#1100S1P(`1P0Z H P   P0 S  12S0 0 020!"48<#800@D@P<4<("4 <000!,  Sl0l00<4<("4$<,$,08#$%, T$l ?@R  S h00X X00,$,!$#, `  0 02 00(  ( ЍG-@pM00 00<2P,$ Q (6 S30#00CS*;00C3h1<00h1 0H0I庤`@  $01n1ŀS=01c111S1PSu01T`P``1Y !P0P000 S0l!#R 00)  000)(0(0S! 00C 00L0( P 0?0X0\0 0``p  0p T00D T0Rq| 000P 00)  B Q000)Q n\`?@RЍ-P 00^S00cS@Rp@-`)0PU*0 Fp@P  0S1ó 0 0SP0 02p@0 0`PH0IPT0 0 0  @<0 D0op@R@-`)0SX( \1PS2pR, 00cS+@T( 0a@ B0cS* P;0T Qp0@ D T0 0T0p7t0S$P @M0 o@P 0 0` H0I $0 0 0 0 0C<0@0 D @R@-@@D>1P 010,DR !@.D0D !$!,4!01M? D k?@! ~ y Ly 0@-P@AQv \v v v v v v v 1S KH0p0@00 00@& 0@&@R$$0@-P@t0S ,0S M'1S k"00@-P1@Sn01T( >S2 (@( @ R #x0PT$ 00C 0:0:00蠛p@-@(0P`V?0S  V 0? Q <P L00S <0?V  PQ Pd0 PPPV (0S01010S p|p-)0S1S(0S00Sy \0@-P)0 S200S  0@'0 Q$1Sn01( >S2 0@10(@ (0 R #@0PT 00C 000@-P0` x!@pPT D@PTU 00)  e 000)00000@-| 0x0CP RD D0H0T@0 HLPS00)  000)0@-D RH0H0HD D 0<0C@0 H0RD D0H0HL@D RH0H0HD0 0H ,00)  B 000)G-1p !WX*1 QUK 0 `QDw0SA ( \1S26 D!D0 0bS,:,!0Q 1Sn01(@ ( @ R #0PT 00C 0t0S 0 1> 0 Z PVH0@ 0p1W:( 0 0!0C  ЊT"@RtxA-p)0`S 0Sp AW00S  AT0S M0S Gr1TS T0S  R 0R R I00I0 R 0R R?@PPPXP\PT,QL 0FL0P!PPd?00 R?0T@T@\ 3`PQ l N$`P 0j0` TQ+P0 D0\! 0D0P$.G- 1M0q WZ 00`SS41SP y_@(Z 0 0cSPA0S8Q0 00Q$0  )P 00C0   )<10 0C<1l41S @R|D$ 0K/000P#R  81@8A0QPX pW R.Ѝ@-p`p0p@P0S 0c cR P 0S Wp!@`VZw @R-HH0 0R 00aS  @R@-(d0"H,kP L L0 @  0C0!\0 0 LԊE-`"!H0P00T)@2@"82p4"P0dA\00\0S ("(P 0 S PN^^e 8#H !0 0C0P 0SP$  R! 0S .0S7.Q  0R\ .0S (0 S R 0S RQ,PqP& 0S.0S (0 S0 0S .0S (0 S00A0S0  0 00P 0p00C000C0mԊ@-| 000@pQ 0 0 0 0p 0S  R 0 0 0  j00C0mL@-(0S( 0  ( @ R1 0 1d "! "0T00C  0S 0 0$0$00C0mЊT@- 000$@Q& 0S$$ 13#01 $R  pR 0 0 0 p0S  R 0 0 0 $ mj00C0mpL0@-P8@#ǜ!\ 1S0S S 0S S^ 0^@ P \0G-`p (" $(, M,"X0\!48<#H 0S 0Sdd0 0C0! R 0SR8 40 S0 1S \ S'0^#0S S1S S0S 4S\1S \ں1S 0S ` p RHx 0 0C0! R 0SR Ԋ` ЍG-Ÿ0 00A!0 0C0!Rm 0Sf0Sc !P`3.0$4 @Q 0S 0S0S0SC SA $ %!DD0 00CpQ 3.0 !0S0S 0S0S S(0S Q0 0Q 0S 0S0S0S S Q  Q (0 S R 0 0C0mԊpЊTG-@M(0Si0SR 0S S`"00S0nh 0P"R  0S Y` dPH”2  1p0彺P0U0V\ PX`\P 00)  B 000)  0 坺P P0 P 00)  B 000)dy<0P 00)  B 000)0 0 fPPh`  0PX Q  0Sd0S 0\ d d00`P00)p  Bp pQ000)Q ib`2 %d"0 #P2S030X2 S S0Q   0 SX d0R 6S?33 0 Ѝ-09E0S\ 0S0SS(0UNS 1R 0R0@-MP4@\ 0 0R , 0R 0S#0R 0 \0G-M00 0P  00m 0 0P3%0AP` T!48<#0 4p 0S 0S0S0SC SA . &!@ß@0 00CAT 3%0Q#0S0S 0S0S S(0S@ @T0 0AT 0S 0S0S0S S @T  %@T (0S8"000P` (0 S<4<("4!| 0  A0cRn: 0B SFT  | | | | | | L ,QL0P!P 0dL`0G`) RR00 R!48<#z(0 Sw <Pt X2Sp <04 RkUf0 aq`_(00SPS< SL00S | 00 0O0S  00SG   0@P@ 0W 0008pЊT@`p(P#<10C<1 R 8!00$ t0f R  0 H0   0a)0 W2S a DaЍp@-P`@ ` !eH$H$48<? 48<#8,0000L01Cd0>DH P TX\`!@p !M?|@R?@ 00000  0X!00s03k? !A01 y?$481!<\ R(!%~? 0hl0?|"xB000  Rr! 0#10Sq1 000 ""u!`0uQ10S 0< 0 0000~ y Ly @RG-p~`P0ßM@4TVQ 0S0@@H2, 1㔴P`  !48<#Ƞ B0 ! R 0 SR P X @P ~1 0C 1 <`000, d ,00 !48<#8140PP2弃P2S03 34 ,140S*1 Q44 40l R*x1 Qll (0 S1X!0 1< "! "0,00C  00S 0 0$0@$!1pR 00C 0 P 0 SPp0S0  0 0@0 0p00 @@ 000 0SԊ ЊTV 00)  B 000)Ѝ@-p`@M  0PP( < 0bS#00aS0 S8!00( R ~/00C0<10C<1$ 0a 00 0DpЍ@-PM2@S  hP0 \0S0\000S^H1x P000)@ @ 000)( R \0PCX(0 S7 0`  P|  0^ P  W, =`PU! 00S 0S 0 0 0 00 @@x) \0P 00)p  Bp pQ000)Q bЍG-@Mg0Sp \0b0a \0 %R $0P0$0i R R ϖ``  !48<<   ((" "( 00000 0#21SQ3S  04g`"3&0!48<#8 0 0 ^ P4 0S 0S0 S0SD SB LŸL% (!0 00C^ 3&0a"0S0S 0 S0S S(0S ^0 0^ 0S 0S0 S0S S ^  #P^PU2 <4<("4!<<0   00 0""1C@0d<4<("4! 00)  B 000)20d \R 0S8#" , $ ,8 #$,,%Q 0S gHde f0@P`P@ P` 0d00 % ЍE-P!3%0 ^"48<# 0 `@4p 0S 0S0S0SC SA $ &!0 00C^ 3%0Q 0S0S 0S0S S(0S ^0 0^ 0S 0S0S0S S ^  apЊT00000@-@R?P0H1P0K/30L01CP H d0"1V(000 ?,1 y?„4Q81T!0A-`w0尀S t00)  B 000)TPR  )p00Cp0p R  000)R _T R 0 0C00PT 000@QP  )p00Cp0p R  000)R _ R 0 0C0p PPP@Qp0S =@-9||@2 9C220 20P40h0 <10D24&- pR 0 0 0 0p 0S R 0 0 0  ]L0@- @000P1pQ |0 t0 B \ 0S\p0S0  0 00 0p00C00mԊE-!H$P8#8#$(,"xXhQ 0S 0S0S0SC SA . %!0 00CQ 3$0A 0S0S 0S0S S(0S Q0 0Q 0S 0S0S0S S Q pЊT@-H!D !0 @00 Q  0$0 $@00C0mH 000$Q 0S$$0  $00C0m@-!@P 1St0S (0S 0S S 0S S0S S P00C0mp@-P`@MW2 S (0S?0A S  qPGP0`qPRR!0P` ZP0X"`R`!48<#W2S  0 000W2SV Q`Ѝp0@-P@@0x 40S 0#<*Q  cP0 \0S0\000S0'1x P000)@ @ 000)D 00) @00@000)t R\0Sx000  )p00Cp0p R  000)R ]0 00 00x)t- \ !48<#R0\00 0 0- _@-p@P`_P U/ 0S0 08#8#$(,"(P Q   48<#8 000A0 0 0 0 0A088"0#800G-Z`p$M 0Y#*0^D 0S S@0S P 00S0n00S@(0S z`&@0 0d0 S  `Pi 0S 0@S P2 0 R T2PSB0S T= @H2"00S0S\200S`20  0:PP! P0 P {0S 00\  0S 0X   0PTx @^@PY j\ P 00)  B 000)U  $Ѝ@-@0(0 !0t0@g0@-@(0PSR0R#0SP PP P , X1: 0<0Qb00PPd000d0<0 P 00)  B 000) 0G-`P M$(^6Q00  ,  0_@P% \pU0p 00  0_P -0Z  0  L2S Bx_PЍ-1SГ@-R1#, 0@ 03Q "\ 0@- P@<0 0 3R ^ 0P# 0003Q R0  003S \ 0@-QM @ @ R[1^S  Ѝ@-QM @ @0 R[1^S  ЍE-"!0@00QL1 `\0\00Qq01S0^/ 0b0*  R 0SP Q014^ 0b0(8#ǐ"(\ 1S \0S 08# 0\ !0\0R0S  0R  R 0S R.0S .0S \00C000C0mP@-H!D !0 @00 Q  0$0 $@00C0m-X 000$Q 0S$$0 ( 0$0Q000C0mT@-P8#8#Ġ Ƞ̌8 @`!,Ƞ#p^* 1 S$t0S (0S 0 S S 0S S 1S S  0S S RP RP@ ^G-`P (" $(, M,"H0\!48<#80 0S 0S8 000,01S P0`NmQI 0 q1Q  Q5t0 S (0S. 0S Q S Q$S!Q QQ QQ 4Q \R \R S ` 0SPEu 0S00C0m ЍG-M00R0  3:0往P `4@ 0TpT1P H1 R <1 R01 R$1 R@  0@T 0 P`pᰀ@T 000RP 0N S p l l l l l l l t qP!GP0ZX2S4 0ZP "48<#ȠT&$ @qPZʀ!0PQW2S |0S (0SW2S    07Q`Ѝ!!Ġ Ƞ̌̌ " p@-@P`RM+ 0Cu[P * 㐍 "48<#8#$(,, 0" P00 ハ FJ[P Ѝp@-P@p`R  F@ [ g 0G@[0G- pXP`4M 0Y#&* ^"9T0S- , X1  0<0 Q @T 0S0S 0"00S0n:0S00 8! (0 Rj110p00  0S0(0 S!d0(0p"d0!(0000 0R,0 (@P00pS00SP2000 (0R0( 0S ^ pH2"@R 000S 0 @p0S,0S\2,00S`20pW# <P 0 S <00)  B 000) &00)   000) 0S% 0 ,#2?叨@P? P0 @ {0S7 W <0S P 00)   000)< (0\ S X0(00 Ƞ,Ƞ, !$z@(T @ 0 @@ P 00)  B 000)Z 0WT   00 04Ѝ0-Q 0Q ):l P0RC<0 0003SD D0R R\0C<0 0003STG-p@ M$(`   B? $ 0QZPP8 \0CX0 00 0[P% - 0V Y㰐00@0 0  '$ 000 00L2S z ZЍG-R@pMP d 0(0Rxv 0R0R  R`m<0P 00)  B 000) `dPH2 0kP0U0V\PX`\P 00)  B 000)  0LP0P0 {0SP 00)  B 000) Td0S0\ d 0S0\  p,Xq 0(0R0C0<TЍ@-@0(00t0@0@-P@@0x 40S 0#<*Q  ?\P0 \0S0\000S0'81x P000)@ @ 000)D 00) @00@000)t R\0S000  A 00)p  Bp pQ000)Q )V0 0000x)tG-`0 , ! Q4p\ 1St0S (0S 0S S1S S 0S S0S S \P\7  @ T"48<#  1St0S (0S 0S S1S S 0S S0S S @TT UQ $PU00)p  Bp pQ000)Q UA-M 4@0 P`T01pᲀ0P 0 R 0 R0 R0 R  0@T <0< D88P`pᰀP PT&$ ЍG-P M` 0\ n pl\ 0 0 0 ("48<S#H  T00 Z0\@00S i0S `0{i R ᆉ 0mP0  0|3S @@40`.0尠4@`T 1P 1 R 1 R0 R0 R`   0@)T 0 p尠``V@ 000)p  Bp pQ000)QtT&$ \000  )p00Cp0p R  000)R T ЍA-`p!X8M#HX0P 0 R 0 Rx0 Rl0 R  0X (0( 0$$`pP@T&$ Ѝ-%R R ; 1R8<4<("4 <## ]   0 0tS 0rS 0 00C  0  <4<("4 <##  ]   0 Q o `z@-@ P`XpV? 0S00S0@  T00.Q  @00?0C%0S @00o hJ Q  @00o `?0S8080T000S T0 T0 0 @-@(0S L0S 0S 00)p  Bp pQ000)Q SE-PpQM@ `X 0 SP P D0 S X0, R 0 p p 00@T Z00S |&40@cT  h00  0ЍP0@-P@ P P L o hⷉ0 00o `0&A-`M(0pS 00)p  Bp pQ00 0)Q Std00 0Pi8A000  $0.gPPG !00 0 S iPo ^00),  B, ,Q00 0)Q 0Sg0/00),  B, ,Q000)Q 0Sg$'m`@R00)p  Bp pQ000)Q R00C0Ѝ@-@M \  8Q 5d 0S   0f88P`ЍG-P@ M 54ko00Q`Pa 5 00  儀 o0 0 \0Q 0\0 QZh0(P7\0"(000p\`00%@0"48<#8 ("(0"4800S6| | | |  D <1 R 01 R(7mP%  00#!ᔗ [ 48<#80 0 R mP  00SD|0 RP mP9 P@  0@0 00 A(pT @XD(|(( @  04@@a@PQ 0@R0S  TЍ@-R M 000@0@0S S 0  0#Ѝ0@-,0HM\000 HЍ0p@-@P R\M 000/@ 70?P B8c02c2cA p0ab /N#b!<4<!4"D    (      U f00-0V@P 0 0 0P0   <|^  T0CS  P @ %|@TpD) E-@P` fPf R\0p 0\0!D 1pp p0  000  0 4 0S 0CS= 0b0S 0CS0 0b0S 0CS# 0b0S 0CS 0b0S 0CS  0b00f0\ \0bS0\0h G-p0MP`0 V0 0ZQ @PT U 8 0aP@PT(`VP\d Ѝp@-`PM`D@P0 i02. 0`:P00)p  Bp pQ000)Q D0 01 0w 0D00wЍp@-``0$@X0T   P$@ 0S<@(PT0   |d tp@-@MP`T@ 0S 0U0U ЍpG-`PPM`:C@P< :.z //>ҏ $ p 00 \0`00p, V 0D24 @"` 0@2D"0T`2嬒2 3# h3\#iPD| *0@Ѝ@-0@T 000|C@-<O44@XM, ,00EH@$ 8vE-P00)0  0 000)ᦙ0, R y0S`pD@0y000) R 0 0C0@ 000)Q  )p00Cp0p R  000)R C@00) R 0 0C0` 000)Q  )p00Cp0p R  000)R C@`00) R 0 0C0p ```000)P  )p00Cp0p R  000)R gC@0S/PP,000 R 00 0000C00 0C0PPP C<P 00)  B 000)E?~? 00)0  B0 0Q000)Q @/E̘m@-M@4 R 0 004^Ѝ@-M@8 R 0 008^Ѝ@-@Q+0TP !"48<#82Ll 0000S00 @@ 0000 S 00C0m0@-0@S2S 0QQ#(0P!P UN 0 B(01S*0TP (P0!"48<#82  0S00 @@ 000 0S00C0p0S <0) P 00)  B 000)0L"0800m@-` M2P S!#D0pS  @  UD0S] "00S0nD00 0n>@P 20CS>8. . . X0 X0 0U0UQ<2 PRX0X2$2$r0(0U0U  Rvr2Pz X"0, X1: 0<0Q^ U` Uq!0.X2Q TL@0 2") RpHxBT1PS„|0V2U2\"d"D„# !"48<#82L!0000S00 @@ 000 0S00C00(0S PP =]==\ uH*XT*X@Xtmh Ѝ0@-P@T 0S00Tx0S <0 01100 200@-@0D0PS 0(0SR1S 0&0SP PP P , X1: 0<0Qb00PPd000d0!$(,F57S"a00AD!8#R:, X1; 0<0P 00T0P!)001"48<#82L 0000S00 @@ 000 0S00C0<P 00)  B 000)0<00mp@-P@`P p0 0S  Pp^pp@-0@M 0800) 0S00000) P` 00(0S (0S0S1S 00)0 S  0S000)ЍpA-`@pPLP\i\ (<2!0S 00)0SB1S?  q0 ^Rw CP 0 ) Ph00(0S0S (0S   r(0S (0Sm<0 R 400( R 1S)0S7 (0S4 00)0  0 000)(@ ( R #@☕0PT 00C 000)0  B0 0Q000)Q =0)00.0`:A-pP@0`S805 00IpGS0  P' @80[80 刂B(0S 1S (0pGS 00~>0pc0802t`刂>0pc-S  (H0!0Sj1000Sd0000:@-`p MP@0@ ^R SP @0   0@0@P00 Ѝp@-@P:` 0   p0< R^p1S `pP0 

<> @? p> @? @? @? @? > > > @? @? @? @? @? @? (? (? (? (? (? (? (? (? (? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? (? (? @? @? @? @? @? @? @? @? @? @? 8? 8? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? > > > @? @? @? @? @? @? @? @? @? @? > > > @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? @? 8? 8? <0 0 3RPi\0 S ` 0lR X1  0<0Ppp <0 0 3R00p2Sp, 0  03Q gv\ pp@p@`0S0S pp@@pP  I7@Tb0@-P 0d2'P  27dBT0G-M$ 04x1p` W4 @T. Q 0 0aS࠱4 0tPxP`U $ 0@ n%@@x` R` 0RPU(pW0i`c0 @V`V0+d d+@R`+h+|+Ѝp@-8`@$PM T@ $0S |Ѝp@-0 S <0 @0003S@T 0$ Q |@-<0 ,0 @@T ˀP`R@-@`0S0S#B^p ZPE`` @wT0\U  0C0cPP4.<.P0@-@ M Pq<00 @S  P0S `00 Ѝ00@-@ M 0S S Pp000 @S  P` Ѝ0E- M

0S;0 Q6 0   v  ``@0 @T 0S0 0R 0 S 0R PV `@T 0S0 Q 0  `@0 00 ? h00./PP8 gp 00P0Q00 @00   0 D0 /w00C0'w 0 D} $ЍG-`M 0$0 Q Z 0Q  f0  y<4<("4(< a31#:##5#2#01@PXbP@T 0Sp@T#0RW R 0S R 0S 0S  0S  0jPpP@T 0S W, 0@ 0<000Y 00  v\00C0000 00v 00S0ڦ`ЍE-0P U' 0SJp1 `A@P  R 0 0 00#p@PV00h0PU `G-pMP 0U- 0` S $  0S0Y@T  Z  pp 0X @T `YPUЍG-0,M(pP$0W _ $ 0RUzf 0XC X< mf0S5 1S2 @` V00( 80    0 0 0 0  0 006P @`T `\0S00 ` 0X\0S$  $0p0W$0$\,ЍG-pP@M@< \ G-`PH      @P0P@PP00)p  Bp pQ000)Q$ .!@@D@0 00)p  p 000) 4P00  00wЍA--pP $L0L LLL@LPL`0  @P`ep t w Pz r | { G-PpM  崢2,`! P0 P~ P{ 0 1 R  Rp Rm1 &@h h1P  P\ &hPUV1#!   RJ RG0Y00@ S? S<V 8!R8 0 S  R. R+V1! 0R00P0Z00Z03 0#S V!2! D0P00R\00\03#PЍP0St d l | 840,($ ////////E-p@R8MUe w<@lq@0S\k P `H <4<,4.<#Ƞ #P#<LDL,D%L$$Ƞ $P@@`%Ġ Ƞ̌,Ƞ$&Ġ Ƞ̌(@,Ƞ,$.04.0@0S P&0@00CT:0` ,0,R\ /00 0`0l0x008Ѝ 0S R0@-P,0@ @T gP0|0@-@0PS000gP000gP000gP000{gP 0S0  000`hgP000@_gP 0000//////A-P!ba0pQ@ TT W < P0@TW 000G-0<0M0 ,ß$, 48< ,Ƞ0\( 0  0SXP7LP4 ( ^0P P P   001!$(,"SQ 0  X R LP (.X ,0 XP P) /P ,P) "48<#8!$(,$0 0"( 0S000Q0#$(,"(!48<#8$ 0 R0$0 p,0$  P} XP}T0‡L#$(,"X0@D 0@! ,$   0 0 670 0#0! 0P000P 0001 9 03!(,"(P!@u*PP$ 0\ 0S 0\ !,*0@P 00,e D^a x0KP TcP  i8pWoW4 <Q% T1l0\ X^  E T K T 00D<0$0< 80 0< p8@0S8p4 S T @,T 1n0S  0$ p00Њ x01XP( 0@00#$(,"X0@ R 0 S~ XP00^0S .( 0Q0R0S ""48<#8S0 ,48 <#800Ѝ@-@T D b8@T@-0Q0 < 8@R 00C0)T@- R@ R8 PP< R 00C0< R 00080D 80w`)0P< R000880S8<Q 000-R < 8R 000 R R8 \\< R 00080808-\Q < R 00C008  })QQ8 80S8P < R 00C0808 8 g)A-`@PpTX 0RM 0RI 0RE 0RA!1 0R;!1R7!1R3"2R/!1R+ 0R'"2R#"2R&& dP<<0QQ@ @0RQ 00C0W 8080800 )p8@T0(0SX0@-P@cdP0@ @ P WdP P00SPU 0 0(0'0|A-PTp`@(Pld0P0  00p`@0 P810@-PZP00d0@ R  dP @ 0SdP  0|p@-@1`?0S 00p1S 01R2S 11SS Sd'PP 00p8@@P@T<@L(00pd00T 0T 0T0<0D K`&0S101080p|@-@M0`0)@@ Pꐗ 8 < ܕ  (  Q P PP0  QP PP0 000)HQP<PP00 00S0+,0 0DßD0@0S0000P    0 g0h0o0(00n00(gTQHPSP YPP0 P PQDP=P CPP0 P TQ{HP(Pv .PP0r Pn iPQeDPP` PP0\ @PX V'QQMPPH PP0D @ Q<: Q694Q0 PP+ PP0' 0 pU 0U 0U 0 0 00S꼙 ܙ ܙ 0 U {mm|00000)ЍG-@0|M`P0pPxtLp`P```P0@\< @<4̃8#4",`  8 #,8#.|t|8#t"|phl P`>6$0d0pP (070& AQaqᰂ6\02X00T02L0\0R@,P&0 00`\@XPT`t `04p8<@@DPH`Pxd\1/|ЍG-`p M`@000)PU& @8@pT WW PU _ `V`|,0S D b^8@p`T PU@U00 0)   0h0 ЍG-PM<84LHD @000)0$! ZP  L <0(,$  0`Y0(@8(,, 0$ 0 0$ 0, d($ Vd<40D R<@0R8< |10<04 <Z80000)D40< c b @L0HP PЍ0@-LL M0 @8P0 R    0P0mm| Ѝ00@-@ M0P01S0\ RL0 D 0@ R      |mm Ѝ00@-X M P@@@ 00 R    0@|mm Ѝ0@- }@ w0 | q p 0 PX T@T H80P,1|122u dx,2A-P`p0 M@ T    0PT 000 h@  0`  0Pp Ġ̌X┇%Č&̌Cꀸ@RT2pv ЍG-\3Mp\`<4<("4!<C 0  S 3  aKRP 0@  0 Ġ̌.Č$̌LP ń C@DP2 PUp"0 00T2TB   "`P 0P<4<("4!<0C0 0 , 0! $ 00X0P34P 0S  @#P4 XP 4%4PX0 0 00   0S0, @@H21tP 4P M$1,#M0$  !0@S000S1PBi0P0 @0P\0 0 02 00<@<@P (@81`8ah@RvT2pD?<10C<1$ "DЍE-p1pq@TF `0S O_P: 560S3  N_P- T P[RP#* 5PPU00Q0Se0Pq "#P @ p` P000(@T0S 00S 8T0Qd $h2p22 220@-<0@ 40 @P z0$PT0$(@-, @0 02 02?U<0 @" T  "/@-, @0 02 02?<0 @" T  "/E-  M P@X[0 x^`㔠0pap0Pt"ll0ap0PPap@0 0  P  (3L3x3 Ѝ0@-P0sTM* @T[|0 0,  h03P00 2( "1!P 3 3TЍ0@-0 R0"i^0s0 0@t|0,$,8#$ ,0 Z1S`0 2S iHa40h(XH  4L4A-`Pp  0   ` !Y^ 0@S t`@h0p h0 P`@V`PD004|44p4444@-11P` 1@ 2 0S:KP0\ad 0S:0s @q0s41 r (10PU A00IPPP0ch0]h0Wh A?X0LhGhpllhu4@R $5(,5D5X5d5p5Hx55555@-@83]P ,.]P 0055G-@]P x]Ph1PQTO 0SL `8pAI:YPP`]P8 X5į ԯ  \ x g0 g0g0g0Pp.YP @ `\a @ \t 0`0`@ \`@U 0S55HI- \00)  B Q000)Q 1!0@-@0DmSP0Q 0S RU 8 #4##2#00pTp@#00\0 8Rp0p0p R 0 00S 00082p0 080p0 0Sp@-`0#0 pAPT 0S  \P< R   )00000   ) @T萫0h 0P $2S 0S   )00000   ) Pᐫ-00SP0SX00)  B 000) 0 0t2`@R$ $0 x 0|"t2R@RL @-P@t@(0pr Sl0S@T 0S0S0:00)0  B0 000)p@-`/DP00) @R @0 0C00P 000000)T (0 S  )p00Cp0p R  000)R : $P Tn0$200SP0SP00)  B 000)p@v0 (0t p@c0S2S^ 2S Q#L 0(0080\0 B20 20 2@-pP0 `R' +@P00)  000)VH0202< <0C$2"?$ 8" ̰ 5ЫQ-\"00R R R <0002(00] P  P-Q 00R00G-`@P 2S$2S HVW 000p  ]0 0S 8 #4##2#0"4PP 00)0  B0 000) B< 0 " 1825@-`pP# )0XPuP,@>mT < R Z 00)0  B0 000)  @T n00G-MP` 2pS$2SYVcr `Pk  @P e 2S$Z [  GU`  0S| 0P 00)0  B0 000)a9r B 0 "+00 B 0 X`v00)  B Q000)Q \va ꐫD0 $b0 182M ꐫЍp@-@` MP\PL 00)0  B0 000)00= P800"0P/ 0 S S R 00)0  B0 000)\ 00)0  B0 000) "0S 2S ЍpG-p M `PP< 0@P ~/0P:  )000C00   )t0S(0 S n <0 R PP  0pW Wi000000( RY0C0t R(0 S~X00UY 00t; <0 2S P00)0  0 000)(p?φ`00)0  0 000)(p<p\0A/20 20 2 P 00)  000) " "$"R 000$"~0D 0000) 00 000) 00)0  B0 000) + )X 00)p  Bp pQ000)Q $U T 00)0  B0 000) Ѝ0@-@P00)0  0 000)  )00000  )\ A?"" 0""0  R 0 (0(0 0G-M0 pS 0 2S^u(0 S p nD`00) @R @0 0C00` 000000)T 0 8<0 R lG<0  P  )p00Cp0p R  000)R ~Ϡ P<00 !R  )p00Cp0p R  000)R _0 0P80@㈢80BЍ-S 0Sj 2S   R 00 00@-08 8P80 0@SJ 00@TZ00)0@-PM @S 0S > Ѝ0p@-P 0`@SJ 00G@TZ00 0 08 p( G-@PMp^9@0SQ  ~P0Sj l Y0 0Y"0S 2S>  0 @@@0K`P ,0 < 0S 00P  \0Q 0\0!   PPU t0S 00)0  B0 000) 0P Sg0 0k U< 0 BPP_ 0 00 S S RI D 0@R:0@;t0S:+0S* 0R*0 0)@ 00@``000) 0S 00)0  B0 000) (0 0  0 000)0  B0 000)00)p  Bp pQ000)Q  ЍG- M p ^9@0S 0S (0Si^0Sj :  r0Yl0 Pi?00CUPU0. @0S@PY{z,0P N < 0 U PS ` \0Q0\0! P  )p00Cp0p R  000)R YA @t0S:  )p00Cp0p R  000)R lY#0   Ώ D 00) 00 @@000) 0Ym Ѝ@-@D0D S0S "0808m"080E-p@`@ M ^@  0 PP8 jP 00 2S 00  P\0Wp*0 00 0P,080S 8P | p gЍG- M   0@   p 0 ^ 0)0!00!) A"RK`0   0? )  R C)AQKD`00) @R @0 0C00 000000)T+ 0R1S: 0)0!00!) AQK Q,<0 R 0)0!0S0!C) AQK R ,< %UPo 0S 00 2S 00   O \0Y P1P!0 P 00)`0 00D@@000)Q O 00,0  0<0 e(\0U 0e\0 80S <\0S  )p00Cp0p R  000)R < 0S8P z< 00)`0 00D@@000)Y- 0)0!00!) A(QKЍp@-`@ P! :0:U < R0S000* * p-0Q 0Q &l P0 RC, 0003S(0 SD D0R R\<0 0003ST@-@8RQ \D1*S0A <Q8D D0@SP0 P. P p `80S# 00) R 00C0 PPP0   )00)p 00` 000)^ P \ R@00) R 0 0C0 @@@000)P  )p00Cp0p R  000)R { 00 Ѝ2  ᄸ2X 1QD R000 0000C0 0 Sᄸmp@-P 2` 0C8S]pV<00@P  -02bp\p`E-PUD@bx"Tp1S d姾1S,2S 00)(" B("000)," ,90,2`0t000) R 0 0C0@ ```000)P  )p00Cp0p R  000)R @00) R 0 0C0p @@@000)P  )p00Cp0p R  000)R (2S L@000#(2S2S 020@0SP@T 6-0d, 2\022!R <2QQ€20C R脸p@-@0PS p0S , X1: 0<0Qp"R 0S02p0S`apD 2!R 2S Rb02p脸-0S2 2S0S , X1: 0<0^0"20R 2{ S 20 "20" G-PM , \0 00 0 3AT p`p2 S  )(20(2   )$2S 0S 00 0$  )(20C(2X800) 0S00p   )00@ 40R[X  )(20C(2  ))00C0 R  00 0)R q 00)0 S  0 S000)  )00C0   )0So  )00C0 R  000)R 7<gX@D`00)0 S  0 S000)0S  x @  )000   )00)` 00` PP000)   )00C0   ) ꄸx) @T00)p  Bp pQ000)Q nЍG-`M4p` 0\ l00)  000)@2!Pp U  R 2 S 2  0S i01  )(20(2   )Vp0S 4` `  )000   )Vi01K$BT 0S @@ @$.@ 40R)ʌ0S 0x P0  )@00@0  )D00) 00``000)\@T i01x)`  )00C0   ) PUd4 R00)0  B 000) RGV 00)p  Bp pQ000)Q 00)  B Q000)Q ЍA-PTp A`T U 2S 2 a @T脸G-`MP ^|:@0S0S 0S ppW , X1: 0<0Q] r2S 0>@PhO 280"@Dp< ,0<0`X \0Q0H\0p  GP 00)p  Bp pQ000)Q E , W 00)p  p 000) 0b0 @0<ЍG-P@ M$`^3 0@P- \pX0p 000 0 0Q 00800D 0 0,0v,2S 40@ ?R9PЍp@-PU` @P 02PpV@bYp@-@\ 00)p  Bp pQ000)Q @G-p 0MPPh` ,bPD 00) 00 PP000)A@0 8\0P0\0 0000 0D 0@00) 00 PP000)\ ,B00)(" B("000) ЍA-$@p`yPPhH $I`0p 000)p  p 000)@"08P 2S   )(20(2   )@ P@T9n,bV,RL- )(20C(2)脸G-p`RM $ 000NPP& $@8 \0$Q$0\0\ 000 S000 0 3G 8 @0x Ѝ0@-@PP ,0 40 2$R10h0\@-@(!000 40船\0@-@@0MQU0 ,0gH0 0 0CꈹЍ0G-p `MNP AT 2" @P ,("  NP 00P RP 0R @TX<0 0jPc U PU 00$7d7Ѝ-e  0007 -0 4*0 0 S  -$M0*00 00 0  000 0$Ѝ-$M00* 0 00 00 0 0 @0 0 0 #$ЍE- M*`V<0 6400@p@0S( @DPP$ 02@0@P @ G0000  @P0 Q \u0 60 Ѝ@-0 *, 1@@0 <0}\*0S$$$ -]'P$77E-@pP`@1   00W: 0V7* 0aV3 hP@P0 h1Gp00  00ss0,0 0400 00 < #R 00 0 PP `PJ PD 0D0HD E0( N@d7(8H08\8@-@`0  T D 00 0;$倷0S@d88@-@X0  L nP 00P 00d8@-@l0  ` R0S 0CS0 4G, 0`0S d9,9T@-̠@ 0 20 (R̠ Q00)+ 0 "002 2 0   000)-00) + @20   00 0)G-M 夠P 0`@0 @p @ hZ PP 0H0 0P   0 p@W @ Ѝ<0 40 6(@06 !000 6  $0@0( !000 -0 @0#RU! p@-@P0  ycV 00 0m 0}p@ 0 0@`pJPP0@0pH0@0 00 0d 000p@D d\99t99$ 0@-@ 0P  ; Q0S  Q0S  + 0S0@00 s0 00 0d0@ ns0 HD0@00P0@0U( 0 0@P0d99 :\ ,:0@-@P0   ,0 S@ (0 1! [PU,PT<0 R ,0d@00@ 0@P 00dP: t: A-@pP1   (0,@  1! 0 `\  ,0h d0( 0\0 00 0@Q ,D(0 1!`PH0 PP( e P@d: ::;@-@40  ( n 0 0@ @d8;@ 0@-@h0  \ Z 0L S@ 0( !PU< @P00d\; p@-@` PT1  H 7U41@0pnu$1@0p u PU1@0p,0S0@0p0S 0@0p0@0pku 0@0pou  0  0@003pou  00SP 3  0 < e0@0pd;p \    ;@-Pp`W @SP D1 7 830 0S0 1   0  D0S 0 0@  6 W06  & 0033S`0@0 WP0@00S@0@0@0 0000 0d;;<@<l<   @-@X0  L k 0S4 0 0@ 0   @*d< A-@Pp(01h!0` X F 0 6 4 <608#86 R10 0@ P3 0 ,Q0,$,!$#< S S6 :00C R:0 0 p 6d @0#6@  4 0@0 0 $d<<<= <=@-@L0  @00 0@ 00 0@d\= @-@D0  8 0S 0 0@  0@0dt= @-`p0-,P000 0 PP$P0 ,@<4<("4!<00P<4<("4!<0(< 4 <( "4,<0@p@-P,0,$,!$#LT Tuq0,$,!$# @>x>>>>?X?2|."P l#=0SJ 0@-P<0  0<`j@c X` 0=0d@A-P0@܁0 = # ,2 p(0dA H0=pPP  `22 22 B0 8,p`P 0 8 ; P"s0Sb!0 =ٿ`0 d0 =Sp 0H00C000C0=p0=Ap @0d4=0=d@@A8ATAmp0  0@-@0PL 0 @ 圿-R 0ns p0d 0dA  @-@H0  < 偿 j0 0= 0=d @`dAG-h#HM0 Xk00 40 ,^,  02S0 O. R   P00  pa ap"0 4  7=000p@040800 0 B$(, 0 @ 2 02? @0 P @2, 0T0 02?0  0U0 j@^Q Y  JBh>,$,8#$!L 0 0پT=.AM .0  10ž >S7`͖P Q 0 S d^ R` 0 x ᩾X  d!>0 >Ѝ=-0 B=- d4D\DBB?BA C$CAM0 Ѝ0`X0 =R$ `0Rz0 .p0bWp!3   lݮ@04080 0 0 B$, 0 ( @ 2 02? @0  P @2, 0T0 02?0  0<0W0U0S Y   i  >Y  8> S0!Q =1pP0 0HNP@;"0   @ ~}00PS p1@W@p#0p0 @0 4080(  $0 ,0 @ 2 02? @0P @2, 0T0 02?0  0弽0W0U0S YY   i  R=10>0 0`0 l. > 噽  @T8 t kt t  C dTC?xC BCC} `V'D00p.00R l>S x 0 lf=Sl.0=R 6 pQ (0 Rl; `VdDDHЍ@-@M`0 S;  =Sj0 0`  B!<4<!4"<0@1S "0 ]#0!0PPlNT "0 &LX"0H .<l~pNlB000`PP@S @! P@P(> S*0\  B\  c Q:P00l0 \0 \ * \0\: @ 2 02?h.PnP<0 @2 0T0 0@2? 0 h лUh>p.0e h>p.ku  u uou edP㷻Qh>S =X @`0 dEF(FT# mTF??= qkqPj0  s p 0 dኻl&L@0 Dh.`04 0 00MT 00C0OdFFm^X 0@00C0T# mlЍ0@-@0PP 0 D Sl>S  0S0l>0@0dFA-@Pp0 8=Sj0 0d`0 d0 0S`@ @0  B 0  dFm$  G0--0R0=p@-P0 S@ p 0` L P0=L P0R:  R*x0S  0d0d0Sh0 0 0 @غh4 0P0  ̺ pd(GXG% G0@-P0@-0  0S0SL P0R: R*x\ ^$L0  GAB BHЍ-$0S S A 6 R 0 0 R0 0$40 @   0\ 0HJdhJ(J-$^0 Q 0 0S 0$0, 0@ 0\ 0dJ(J- 0 R䥨8K G-P@`M0p0@ `\\ ^0 ˷ 00)xpP $ᾷ6 p0+dK@R(J`Kd<`\ ` P0@ ! ᥷Vp 0`0cS\d囷0_LTPX@\`PpLp屦608#8600 0)@RJ84 JЍp@-@,!0`@ 1 0s 1R m00pd0S 0@ aL0d0$0PS Hd 06R M06 PP `@ PT`0@ 03pdK@R< L K(K`K 4L@-@00 @ $m0 0d @dTL@-@@00)000)0@-@d0 @ 0PP S PP00)@T o000)0dxL(J0@-@PP00) R Z0S000)0p@-P`@@00) `GP000)pd0 85 0 04G- PM @!0@ 0&ᨶ6壶<00 00)6 $ 0Ra~^`p 00 0)0@ | |0\ l`Qdr00)`  )0S0G0000)@dLLL8MR006 00  )0 S  0S000)  )0S 0@ 06  )6@  0S 0@ 0@@ 06 < 06R 0<06m @0Sg0@ < D0S  PP8MXMpMЍp@-P60` T0 R Hp@@0Q 4ܵ(@00000f0p<MDME-<0p` 0@ µPPĠ00)@T d0S 0@ ᰵLa0d0606   )`V`pW   )0@ 吵dM KME-Pl`p 0@P 0@ |s h 00S00@ HeD@00(0S dN@$NȺ0P 00Ⱥ@@-P`pl@PC l60, BP6Dp0\!0P 06080900C:0 0C0R @U@ 000  0600P0@ \ 0@ l6<6U H " 000  dLNlNN0@-@ 0P@ ٴ 0R0S 0 0S 0S ,P q0,0P `00&00  0@ 0ᰴ6<8#86W0dNN@-P0@0H S S  0S R 0 0{@ @-@" ? P 0 0 0H@D0@> A-@p``00)d R m606 dPP T_ PH`000) 0 A(K`K  @-P0 @ ?x xp@0T00 `U 0S&0 `@0+& @T00C0dN<G-MRL@\ 2  )  )A5Kv00),0P"2"20   00) nhh ` ;X!0p@ H߳@!0S/ 0S T1?Xʣ``  )0@ ijO0@T 0@ 庳e0@ 峳>   )0S0@ x女t0 R h埳@@]0@ @唳8HOdO48O`O |OOOOЍ@- L@0pS `P`+0S t0 @ hjP20S00)2 0   000)dO@-` )  R C )A5K0@P p@  60@TQ, p{`P#00C0 0 )  R C)A4K` 0)0!00!)A4K(d84 P@P\@ $dPH@-0)00S0C )A4K|!|Ap0P@ hh1 0S 0CS0@P 0000 0 0l 000 00 0 0@-0,$,!$#L <ᠯ0,$,!$# 唯SS@-\0  P刯8@P 0(0, ,0C,0 4d$Tp@-@(0  h@dTT@-@ 1  <0  S8P 0 06, 01|0| 0^ࠣ0 B?!0.1 \!@F/0\\ʌ 0d|T p@-`!X("Hh0  X 8z0P   !PAQA0ppdT0@-6\*L@0 Q0 Q 0C Q0 Q 0\ P PF0 Q P00S0S0s0E-P4p01` < 4 < !4,<0PD@H<4<,4$< 0`y.@@U  <4<0!!<4<0!<4<0P1 S @0 \<4<00 R ej@B! B<4<!4"<L0< 4 <( "4,< 0 @RQ 000 -0,$,!$#QX!0,$,!$#Q!1 0,0 TU@-P`p/ $@P $V/0V00:P 0p 0 0@-@0   0 ޭ0S 00)  B Q000)Q <ƭ/ P md0ULU0@-@Pf\ 0 %  P<00 0@-@00@- `pPF@P& .>PL 8PP tP 00)   000) P u`P`0@-@t PPP LP U f0A-p(MP"hD0   0X000  <V<0p@dUtUU@ 0T*0!R  0 pPV 0S pV00) @20   00 0)ЍG-Pᴠ@#M `0Q 0!00!0s00!00<4 R0 R$0$000) @T000)0S @0,@0$$0P000)0SP00v00%0S 00)00)X 0 P0a0 0S00 PT000)@l@Rhl@-  \@ X1 L1^  P 1`2@0  YόQ+0c 0 000$0(0,000E-p` M P@0LAX  $0D1@0@@$P0@0) XRX0 ` XX0 00S00000` s000)X0)00S0C)AK R ЍG-H$M`Pa $0$L@1@  ) "110S000)K 000)D p L00 R 048#HPU ,L L0?X0 pL "0 SST0S L0 RL 00$@0! Z 00 0-ЍG-造 @101q@Pa!  H0 ! QL1  xpP@T R+p@-X0`@PT 0S` @TU0&0S 尳p4lp@-P`@PpT0ST0S"0 S嗳"0S咳"0S即"0St刳D 0T10\010@P100C10p plllllp@-P`@P  T10\0C10   pp@-@ 0`0S1PUT0S  Pd >sdPpTP \P pG- MP   00)0! !qX1 @@` 0 10ST0S  Pp@`VX10X1  )`1f2@0P  `$01@L00 R L!048#HhP +B `?V `V00)@ 000 S R^Sa(P \ 1a2@0P ` 0 R 0 0S 0  Q HP [H 00 0Q 0 0 R 0  0S0 Q? 0@  81S QSLL1.L!0*L!0&L!L1!11L!L1!t!T10 S S 0((\ \@T 崍+ul(00 000) Ѝ@- p$` P@ 1s \ \ @ 1P0 1 \0 (00 E-`\pP  @d1S" YτPUP @X10S 0S0SY/PUP@@PUpX1 X1 X1T`0X1 RZ@0SX1 +@-@p8`8M Po0A@0S p(`8ЍE-`P`p00PP P4@P& 4IP dp0 0  $00(  ,000 40$08 ( 000T R0,0@T 0@-`@P00@P iPPU 0000`P0S 0S0P0S 0S0@-`@P0@T @P0@-@`Q ,0S 0Q000) R 8 8 , $0$0$000 0)0@-@0@K_ 0 )0   )  )00eS000)HP=0000) 0 )0 R0@Rm0@-@MX1P6 0 <0 R 3 0/ 0U0U'(0S  P0S  $0P $0P$0P?0$0SPZ0   )Ѝ0-- T0S 0H0S c0 @0,1S QP@-P8M@0$!pR% 01`  @0 ,p008ЍG-P?p@ M0-0p @@0 1@   ?llap @@@p`u oF04@p @@@pg 0p @@pW 0@p @@@pJ0p @@@0p 0   8 @@@\\0\\@PpP@(mD $m#4m r|2U p2U 0CU 0CU D2UQ 0CU` (2Uz 1CUw V "0 SS<0   03Q400P   0003Q500Pt 0 003\3 #0 Rd 0 003\2L?00!  Q u<0  03\k@ L1? 1 0b, X16 0<0Q T \M<0  03\C 2L ?00!:*`hk@, X16 0<0Q & '#2? H^) 3, U 0̠ 03Q \ <0  03\!0 00 100<0PX!& 0 <0R V @ 0 0 3R b P0S 4 KP   |  0j@ 0  0 3R ] P @Z<0X!P& 0 <0R\ 0  0 3R  \ 5py, X16 0<0Q k g, X16 0<0Q& T RN 0VK0S0 0#100I100D ?<0X!P& 0 <0R 1  @ 0  003S@T !kU <0 P0003S T\ 0`PЍ -PT0S$R Q |\"48<#80P 0 S  SP 0S S 0P0P 0S\00\0@-@PP PUd0G-P`Mp0=PDV 0@S `' P8 0@S`P&A1101@P0xS1S DH121@P0 `V  0;S,SP@P0S ЍE-ptM3H0hS~0dS{0`SxhSvß<xC aL`b#T01B% \@@@ Pd <h 0v PK p H 4  00 0 00 0 . X1 0 " 0 0X!p X!dՇ!0L@0 0!0!04 0@0!00000 0"0& 0##l42p 0 05 3 X10iS0dS0eS0bS 0uS0sSh 0 Ph 0B.SP1D D匇00B0S, @0 h 0`N Q@0ST1StVtwt &10!U1SgpZ0 S^ 4 t X1, 0X1\X10X1Wmm+nh$nHnna0 0@0 @ a0 @0 0@ a0 <0&! 11414Q4X10X1X! X!,X10X1'h0?0l00p0`8h@a0HA@0S p(X1 T!0X1  ho0o @ohtЍ E-`P@Ph 0#2V40V50?SJ ,ʆV405 ? S405 0V?050 Ra4`4갠p3'S04040Sv!0t0!0嗆 VE4?000D匆L04 50 ჆Zodo ohoxo-bP-P^"--@0pl100C100+T 0S0 00S000S|000Sp000Sd00 0SX0 0$0SL0$0(0S@0(0,0S40,000S(000 $ @ H P d h p t | G-@ M V/0d1X`X1 pP@@d0S ^ P 0 "0 S T0 S0Z +pPp@pWYoX Ѝp@-@`PP00)R   T0S10S 000)pT`n000)! " R 0 @0,1S 0 S 0#1 0 0 \!0 0!0 \4 pLp@-@PP00)1 R 0T R 0` 000)p\4\$T`000)pL-<0 R R R0 04@0S S 0 R R0S 004@-X@00-fAj00)UA-(M 0@`T" 0PUp00 RV * jOT0 0 ` p 0PU(@Touo(Ѝ0@-,Pt@$ P00t0 0o-0t R0#4S (0S 00tQ 0| Ġ04SQXȄQ\ (4oop0@-@P "R0I=A0C  SsX , , , , , , ,  , X16 0<0Q 0oUT <0  03\(!1 400T <0  03\0 ! 0, X16 0<0Q P 0  003SPU 00 <0 P0003S 00`@-P00clR@1@!T , 003Q  `p@0D1@1p@-d 00CS0 pH0H`@ PT*>0JT:00p@1D1*0S <0 R,0 $ S@1 G-DP 㻃p唠唀 ` P@0h %"1P TL0P L0H0`喃o8p ` Xp#G- `p4PP } ,{ 0\ /0  0O,@ 00S0SSdUD T1R H1R @I0,$,!$#,/ ". 0@\ /0  5O, 0!0RR 0 #0Rp 0\ /0  0OG p-rom1fs-ppS qPqG-0M008   #80~X\X%X7o3@p/X1 ύ.XA`"j @pX1X!ύA PP P,  2 02? PP 0!$Y ጂ =`P儂 0"!R 0 100Q0S 8#80P0js(gpq@ qq#qrI   P1Y 0O ULU, c @P' t@?)\1$0S  0.V"2PY? +\Y?+C?  008#80P U|D` <0\1$0S  2 0Z 0 XrTrr\rlrrrru 02?ߍ0@-h0 @R XP0#4S H 0#4S 80 R ,!$0 0uir G-WM MSN@0D, (0夅S0p !0pW00850S%pp[@<5xSS. @T1S p@\1QS. pW 1S 04 p0P!T *S. 1Q J@T:S. 0YZ@S΍ < S00pW8@` 0pW@@p<A|@ @T  !0q0000pW:p|I  pp4ptQS΍ 10L|$ Qd   0 j\!@j$00P0@l@ S. Tc@ T*0PP Q   0R0 0O΍0  0500  < <T 0P `@p0c0@!7A!` R,00jT|00C 1\:0cP, Q *Q  0P&((0 , 5(b0P&(0(` 7J<A 0$T IB* !1`0@ T:L p'@p':0C  0 B c:0C !0S$x1  Y!  QR_ߍۍ@-@P @D@TG-xßxpMhh` 00 V*4C4 0R*$0 vv`V: 01P@U$cUt 0PE7s`cV* 0R*0 vv`V:T0 0 !P@U0U7s`c (2   X!U Vᅐ*ء 0R*0 vTv`V:`e V0 0 7u *`A` 0R*P0 v6v `V: 01P@U&cU~0PE7s`cV*Ƞ 0R*0 vv`V:x0 0 !P@U0児7s`cV*<< 0R*,0 v D@<v`V:`e 0 b0@c7uHHYh9dTP0dUP!eS:h  @D PU0@0 X 0PD 0p`DЍG-1!P@p`5V@fTa嘁0P*1 00TT@T@DT1T`%X440P*$1 00TlT@T00V %X@D`Fv% TF`嬠0P*0 00TJT@Tp 0Pp WD0p^p%T@D `v 0p P@D@<@-IM MppG``F?P S@0 !@T!T0@T T0@T0 p`@P*` `F p 01@T h0h@T  0@P TЍۍG-#3RMMP`UCs0P*x3 00eePU0<0bPEU0Cs0P* 3 00eePU0bPEU00Br0P*2 00ewePU&bPEd"P00\0SN Q4N4@4  *UpA0P*1 00eGePU aPE 0 Q!:Q 1Q10 , P@P T0@,0 !0 T *䐟,0U*p 0R*0 ee,0PU: 0 0!( 6aPaQ @~Q,U0p0 0R *0 e @<PePU &aPE0 SqV 0@AqOQ&UDrDŸ 0R*0 eePU aPE0 Sq. 1@Aq%Uq 0R*0 eePU  cPE0 S_ q 1@Aq TX:0  !1@`P,@@P T*0p%40  0C00 @$$@@P Tt(V0 0(, $0Z@P0K(I @<sT8sIߍۍG-1!@PT`p0P*0 00TT@ 0P@DT0`p0P*0 00TT@T0%Q@DSP@GSG/S G@<E-0TpT TTMP `00000@P D0S 0S( 0C BS 0@Ѝ@-xx 1 P0c @00 Q 0 # 0" QP E-3`M p\*3 00Y0Q*p3 00M0Q*@3 00A0S0SS )P&0Q*2 P00)P  0R*00 0R*00 0R*00 0R*00 0R*00 0R*00( 0Q*1 @00@0P*1 00DD@Dt 0R*00@DtX 0P*1 00QPZ 0P*0 00QPP P `' 0% 8% @% 0Q*L0 P00P0P*0 00T @<Tslsssssst(tkT0P*81 00X^X0P*1 00\Q\0Q*0 @00E@0P*0 00D8D0P*l0 00H+H0P*80 00LL 00U Lt0 T [LXtЍ-@-h0 R T0*L@ 040P (0 H<@@-0`P@p  00P\Q *@P00'0!Q't":p0 00DL-y 00htHp@-0 @P  00000 @0@PPyp l`P @p<y p@DHL<ptt0  00cS@RG-PM@ (0S 00S[??Y?@0( (4 @0Ġ($   0, P 0y`@0$`Z@  00@ 4$T#ZL0p}00gS R g?D0瀐@0$ Q00)p ` H`00)Z "2QQ 2Q p6@( o. k gP <0]0'y Z0 0?0#4p`yW/, - ,- ,- ,- - ,- - pPkP fPaPx"0S xp|xtx 00 0`xXx"p0 0 0 P $0@#20S@   0"0x@0`$$000)`@ (0S3 00S0>P' @00n>D@ (0(00]>b>>@0$ `u@RNEFXPitttttttuu$u,u4uHuPu PxuЍE-P 0@p " X00 R0S (1S  $0D0@0 $ Q 0  (1S @ d00@0$ 00@S 0X00SF `P `VX,!020S' @0$ P+xs@0$  n@0$ @0$ @ 0`a@0$  0>C0C0dS]`V@ $4 pPx@0$$0`$0 (1S @ d0D05@0$ u@RuG-`MX1@(X0T!R R1 R!0S P41X!% hPY P p P@@ 0 0 0w pPp@pWRSw00 000)p㐠@P 0$P  H0S"0 S8#203 ww SqwPvtvv8v0 0 0 X1T!0X1 R41X! SO@ hSY  MppPp Wp  Y X1 SD0 p^P6w 0000x$0  00cS 00 0)p@@ 0 @0$!R !020Sp@pW@RvЍ@-p`@PT  R 0R S 000 0vT 0 00R PMv@- ` M pp00) PA0S/ 0 00RT1X!SX1 X!0X1T1S  X1 41S 0 00R X1 41S 0 00R YOPUPU@lR@l0``PP PPPP$@(000S 00S S?0@T!HR" #;P 0S000)<+ @0 P 0@` 0 0S  0  0pPU0S 0@  000) ST(0@0@Dv R S/ ((X1$ 8v6vvwww$w ЍG-pM0 X p0r ,ҾPD;3až㽾㹾@V Y`L 1V!1 A * :` 0V:`V* `0V0p0:0L0@0 00   $p00(00S 0( (R`VP Q*@P`@0p@ pP`V(wuD :Ѝ@-PX!0u 0@TSuX10X1L1 X!0CS'; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; ; 0; 0; 0; 0; 0; 0; 0; 0; 0; 0; ; (; aaaaSSO@L pP L!YumP$XAL@0L1 QL1 ap0p1L!01XAT0 4uLX10X1,w Dwl`wX 'w@-M @uP`pVd!001PUP@1S "YOPUP@1S QYOPU +ЍY!000000@-@M!PR R) -0R*D0S D 0 ^|D t0#4AS< 000^ ^ 0R $t ^(3MxxЍ00@-@P@!0ST1S' Y^Sς0S T1S  0t0YόY^Q 0Ud1S Y^00000h0A d1S Y^80Ud1S Y^Zt0+y8yp@-@P 0M` 04^P00S+ 0 0 S >t,x9t  ;^  ^P00S 0 0 $tt hyyyz ,1S 0 RЍpG-pL2 M御0 @ 0 ]PP108#HT P! ]P sR PT s (  0!0S xsT TPs  R8s, sP 1 0 @R  00]P 0  R0 "SY   10, PU00X0SX00U0S0 8vs@z`z|zzzz {0{XYݏUY^^ 00`P 0S @P800A@0S (X1 0R0X10T100\ SY`! 0 0S 414a!0S 0SX10X1X! X!Q 1#R Q!0SY1S0000|!0Sp!0 S  R X1 0X1D1Q8!0S 1Q0S 1Q0S 1Q 0S 0 0"S>< Q @P 1PX10X1! \ \P1ST @rT  .`j:g9UZ3Mxh{SL r0S `YZ r{{ Ѝ@-MNP~ 0!@P0T pp!1(&(8"h"P&Q @T@Ta ,q1(Q!8&8(#hQP0S 0S0sQrC 0R0'S08 B Q  0#R00S S,Q0S h0"S#Q0SȠ,ȠD0 &P!r| ʄX,{E|(0 r@T\|Ѝp@-P@0,$@$.0X0@ 0PSP0`@T@0 @bTpPq  p@$}D}G-M@ 00q(PU 0bD$@ T@i8q0HP S*P 0SXp&}~<8H~01;0T!0 RP ;C0,! <88 8@0  @9p7pL ~~t~~ЍA-P`p41\S 8!R Y1S00A@d <0@  t00   @pT) V  Y1 R 0 Rd" \20P @D`PT ?PU00U0SZ00  @Dt 0:S P @D`PT PUU UT h1  w T L`@T 0 W 00Ci R W7 0U\q U U  6X ("(8X ;X  Xg 000)t 0 n\ n>U U OU L|B@R|T\dl4=4㺐:47Q 000)00 @0 000)m $ЍG-NM8 \q\1 R2 W0 0S- ` 0@PY0@S@P WP 0 ``m  =`h 0 04@VH-@hi P P40  b,t| 00Ѝ 00@|BE-`P@pT  0P0R0S X P @TfhPP0 004@-`P @T1p S'h\ p\ x\ \ \ \ \ \ \ \ \ \ \ \         | x t tePP0 00蜁ȁЁ؁ @-@p`P\ 4!R X1 S/L }@yfPP0 00 -Y^ 0010nP0 00P0 00-0M"  B0 \uЍG-P@`M(Pp_@T` 0 0'@V@e@i TT$0  @ 00ЍG- M0D`` 0P08   pP P  P0s @0@0 0P P0 xPl0`PVj 0bPP,0 8X`hp| 0 0 ЍG-(MX!  0 <0 R c Z pZ 0  P`ZJ pV P`V 0:S0:SC@aT@T  FV00@6 1p`FPV KPV 0  $ V P`V 0 @P 0S 0 aVP |Bkꔂ(ЍA-PpT@`TX! , @gPP0 00脁E-`pM$Pd20 3@#D405@fhPP 0 Ă܂00Ѝ@-`pP@HX\ 60S6@ ePP0 00蜁@-@p`TP\LD fPP0 00脁@-@ X!& 0 <0R  PA-p` P"0 S(,f $f 4f 4f 4f f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f 4f f h@d@`@\@X@#pfPP0 00 p@-@PTU` 0S  bP 00,`000 4 0Sp0@-@PTU 0S b0S0-0 a B/  XA-p`@@P00T  bP  H < bP ,0 ,P80p@pP`V@Dg A-ph0S_P`X1  fb@P 0  Y_YoX+ 4@-Ob@P  GbP 000|\[ -b {bꈃ|Aq A4"40 q4"40@- R 0xR6S0x?S 0A8S3a7c\:0 H0 0`AS:40,0 ȁ `R:x?E-`@0$$0S  0 EC/*@0 Z@ P U P! ePᅃ p 0S p p0 eQ000$ PeP@0vUZ/ 0蔃j @-P.0@P0$  @0PS` P 0Ji;0S00 S 0S. p p0 AQ000, `C` 5V0 @S . ' /,0@ @ꠃ\k ԃG-M@0,`p0 @Wp!gSS     00)  gR 000)(00gS0(0<@T(@ 040$ 000) 0Pph   04 0000)XЍp@-@.0@P0$ `,P0PS   0S *0P pX/p0SP@T0@cT p@ n -@0$$00@S+0*0 * +  0006-@0$$0 0@S,-@0$$0 0@S@E-pM@0`(P ( 4 @0  $0@ @0 `@0 &d`&d@0&$ `@$0 003@kP@0 2@`[@0 @0 @$0 00@T0S @0,P /0*0@ S$ ; 4 zTo0S @0,Pl*0@ S$0: 4.0Q`P P,*0(!(S gQ0S00)*0S! @0 P,/0*P 0@0)`AW000)%h/0 @S  / 'j xlL n \k P gg@0mꀄЍ@-@M 0 10S+!0  0  ,P !00!0Ѝ0@-PM 0 1@T"!0  0@@P !00!0Ѝ0 p@-@#20HPU$03 0$0 c0 )P xP:$0`@0$00`p@-  @003 D @08  @3 #4020$ @A @  3 $ 003 |0!1@ H00Q ^ +0S+ ΅+ 80Q $P@f\o o n  00* Q++ *0R000- 0M  Ѝ0@-@PM0 00PqЍ00@-@PM0 00PbЍ0@-@p`HP\ "L @fPP0 00輄G-P@`M(Pp_@T` 0 0@V@e@i TT$0 Ȅ @ 00ЍG-P@`M(Pp_@T` 0 0@V@e@i TT$0 Ȅ @ 00Ѝ@-P8M0`#1p @0 +`00*0S8Ѝ0@-@PM ~P U/P00.00   )Ѝ0G-p @H$M@0@ŸLa0@$6. HP 0 4 0? 5 0  Ul1  ^X? PA*@t 00100A/ @e @1Q @ S 1 00@ˠ d?@0   @- ,!4x @ %@y Hcb'\edlgf$Ѝ-@-@MH`CV 0 9P0"3S !00!03S 20S 30S033 4 2 050306 &R 6S S7S #n02020p 3 30'78S'8w7200CS 0S S03020 3  0p354W P:?0 504 PP:03P2#450 6 05 d0S 6  ;#4 $d  |dWD>ą̅xtdtrd * ^0S + ^0R+0ą+0Sw0 v0S 000& 0R@00 0؅Ѝ@-P`p kP PDd)200CS $0@T2 P6dPE0P  @P@x @-`Pd@`04@pT \Q "@0R 0U0Q0S9\0N4@T FE-p@PŸ`P 00c0FEP񟗚          x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x l x x , x x x @ x D \  x ܂ x $ Td 040c^cU  t1-Thcs*OXA0SK LcF<c4!0,c!00P8{cW4 *1tc[-pcsB)jc$fcac ;Zc 4T RcU |NcxLc80 R dFc`DcdP\xp H1̆؆(DLT\dT0Q R 0S  2: S101Q @DPF갅 p@- hPA1U@M bU? @Pb> 0P b8j 00R 0S   P db!\0 . 0 P 0 0,b$}ḃćԇ_ obЍpp@-0 QPPU 40@`T EP L@T@T 8P0#4 L@T p@>bH1h0@-PP 4 1@0l0 0 (p@-P@l0M `R T0 SPR1S1S(1S 1SP1S >E`!0aꐈЍpp@-`VpQ ST@ 0@00`@ 2pP1G-`VPMs 0 @ rG0j0Sf T 0@S  1`0S Z3T!000S# P !000S @P &  o_P1Ȉ؈ \0R 0S  ЍX0 8#Ƞ R 1S\10\𠱴 RP5@-L@1S!RX*a`0S P`rP` K SS] 0RTG-p`PP 뗮2ܒ@؂T! T0S0S 0S "2R00 R\p  2R h2` 0@T@@00)0S 0S 1  0S 000)mQ iQ fQD0 00 0R 0S  !000S Pau`4@T !Rh0S l0S  7K 3K1Sd01S014@TW 0! !1%! h0S R @h@T0S ,P1 <@-PHp@P4` 0 0)@000)t Q 0 S@-<0`QpU dP/  Jd @JVA 1S T  JV J 0d !18404Q h h0R4 Q -00Sd@-@$1(0$1P $1  %100%1{P(wP0S 0@-@$1PU)(0$1P $1  %100%1ZP(VP0S 1  0S CP@P0E-`S 0TPpU0 0R 0@ `_00S U 1\  0 P0 0 TdpG-SP`M01" RR1 RTXp1 h1R `1@aT!_00S X l0S 1Q|p0P L@) )AK>0 )  R C)ASK R0 0)0!0S0!C)AKHK1   0 5Tp, 0PS0S N   V019# PPp`VZ 0t  P4 0)0!00!)AlK)QC )AXKpЍ-,0 )  R C)AEK-,0 )  )A?KG-  H$M PP 1  c P0 Y 嫮`P V  @&0T q0  S $P 00X 0 S$ϦP $p1STr@P eT TL 1 040L L0T R$㨦P L00L0X@ R$㔦Pv $5L0P 00S  0S0001 !LD000!R101((aP0 a0 R   0S00 01 0 !D000 1R01 PQZ, 0S) P# 0SC ?1   1S 1S 1S 00 (!1011 01X $0S $@Z 㮭 R $50S $/㟭  E]|$Ѝ@-P(A`T T pqD0 X0$qH p00C0yT @AD0 X0$AH @00C0@eG-LM0TP U3 3R 3`@C#\`Vt` Π 0!Rpa1S000W(a1W\T0!U  2X0!Q (\0!Q  PP$ P0!V lT0!Q HX0!Q $\E(1S \?h0S 衟聟1SV !0Q0R  @Y& 0 R 0@0R0S .M@0p)R 0@0R0S !M@0 R 0@0R0S M@ R& 0 R 0@0R0S M@0 R 0@0R0S L@0p)R 0@0R0S L@T  @\LTPȊHl h h0S 1@CTA  [011@CTA  `[01Y@T@ E` R EZ00 "24 ŸR 1S V S4 R0S V S00Yk V@!@Te0S l1V@ 0S 0S 0 0)@000)T `0  @`T0S 0 0)@000)T `0  @`Tꘋȋ 5P1QQLЍG-HMⰢ \ P <0P >+  PD"0P0;8#,2P$2 ( R 0S R   0P; 01P-pQ`A10T  P 1!@0TPpWPEr!L0@b !!@@P80T01S1SPd0S @@T 0! 0  A? R0 <0 R@T  t<0 R EJ 0 0[p d6QU l0S 1S 0 !R1d  h0 1`011S1S1Sd`0SL@n_P90<\!@ n  iZ000HЍ-K@-`p0TP Ul0 d0R \0@厼P FZ00S 0S  T\p@-P@`\ 0SR \ PpϢP p0 @(00)  000)p\ 00) 000) >p pFE-`0TPUx1 p1R h1p@"X!YpW  K?PCX' 1 0Q 0C Q R p>Q 0C Q R0 80S&10cS\0 80 A?#,!Rh00Q 0C Q R p>Q 0C Q R 0* Thl @-0, M01 S 0 A? R0 <0 R @ 0  003S@ 00T0  0Q Ѝ@-, 0GO03Q  ^ @-`@p, M 0 P03Q  ^ G YP P C1P P CG? 0Ѝ0 QQ|0  A? R0 <0 R00 0 0P Q5- <0 0003S 00^ S 0; 0; 0-, l0S h 1Rl0S 1S 1SQ0 A? R0<0Q P L04 R 1S4 Rh d !`01Q P-, 1S 0  03\ 10p@-`@%ppP"<0!PR R !h0R 0 0 3R @@Tcih0PAppP-<0!R  \<0 0003S@-@, 003Q  ^ - <0 0003S\ p@-@`\P000SG0SpG-TP`U3 3R 3@#W00S 1pS1S(q0KHS< 0DS8                             \   0 \  0 t2P 0DS1ꬳ P 1X P <0 R  0D S񟗗( d d @ P d d d d d d d d d d d d д ص @   GG G  G G'Et~EzL@1S l0S 01G) Gd GuTt(T G <0 0 3R00GGQG3V.GV 1G\   0 @0P \   0 0 S@-PP? 0 aS 0S @04@pT, 1S Vh0S  /A"R 0P`R 0P057Q 0ST0S 0P4@T p@-@1  MP^`50 0)0P000)pX1S u΄ X!00)W/U> WU΄ 0X100)/u> 0L!P1T1T  ) pQ@-@   h0 0S::0Q d9S $1 (U$1 0$1d 0 p@-@$1 p@MP^0` 0 0)0P000)pQ0@-P|0|@0U. 01DDW?L1P!8=S) 00))9 a*"*0b9000)) /p9)0 9)11  Ap9+S 0@!9W` 2 _V00   X00)90C9  )! 0{   9 \p9)0 9)WJb V09[Q ` V0P 0 1 0 PP0! Q9S099S;p9S0C99S/!0P 1   p pp9S0C90 1   p pp9S0C9W ˔V P 9 /p9)0 9)|B9)c ;S QG-@pM9S 91 0P0))*b9 cZZ @jɗcI  @l:dZZ ɇI9) 00 9)000);X 1  R 00 Q 9P  00))2R ʼ)P9)0:#: 9)000)$10S0; S0 P  0  2 00P  J0`  0U0Us> 0   Z  /p9)0 9)909  )D1Rp+9R9;!0U100S 00))R ʼ)P9)0:#: 9)000)00))l0R ʼ)P9)0:#: 9)000)I U J0`i  P|B U0@ P0  0U.0U( 0 0U 0U 0U P ;1J `5Z 0U 0U 0U 0   0U" 0  J ) 0`  /p9)0 9)1   ^pp0U(83 0S"K /p9)0 9)5 MJ9`T 9)0J)$JT U 0HT )2Rp,G0U+9R EP;0U !0Uc 0 ` 0 )1Rpv+9R9;!0U100S 00))|R ʼ)P9)0:#: 9)000)' X00))1R ʼ)P9)0:#: 9)000))+,;P0;  l9S Jp9`SI  /p9)0 9)1  )40Rp U +9R9;p!0U100S 00))R ʼ)P9)0:#: 9)000)00))T3R ʼ)P9)0:#: 9)000)1J0`  P :0S . 00))R ʼ)9)0:#: 9)000)  )90"S ʼ)9)0:#: 9)000)00))1Rdʼ)X `1J0@6 00))xR ʼ)9)0:#: 9)000)  )9!S ʼ)9)0:#: 9)000)  )9S 00))0Rʼ) 00))hR ʼ)@9)0:#: 9)000) X?U?J`#J`9L@099 d00bSB)zN 09) @R؍H4J `jNXt0S 90)R,P l9Sp9S  ? ?ZP EP0S  Ѝ@-@+Ύ@"13120!R@0@-PP ) 000S 090 >  0 j 00)N @ Q1   j1 @ c! 0' \1X1T Q1M! 0  F1 B1!>! 0 7!0  N @.1*! 0 N @!11 K00)) )0090 0S D0v9090@-@R P Ν090@-PP0Q0 Pɝ@P TI 0 @I39 090mm G-P,M`$ 0 $(9S\2MC0 D3 QQ 1S!R`0S P`^P` 7$M9! 5!0 10R 0" S 2&2 0R 0CRQ >p)R 0CRQ ,2 R 2 0 S 0 1 0  >0 )  R C)ASK R >0 )  R C)AS|K R 8 f c1 0` ] 00) R0 L 0000)EO0@9%0%1  0  003S00C0500 \ i0 bRRڰ20i 0c09 ;S  @ l 9 S R1.P P  0 0S< $1 1 Q00S 0 0 000 3R 00C090@ 0S 9S ' )00)) *9"*)0C9  )0\0^0S 0 0 000 3R00C0^ ;0CS;0;0S 9S|p 00))Jb9 T@T@!00 0)T' )9 0  0 3R p@g00)) *9"*)0d9  ) 0 0 0 d 00))Jb9 T@T@!000)T' )9 0 0 3R [ @`00)) *9"*)0d9   )0 00 d 0SBP 0 0iS0P 000S $1 (1%!R 0 S . ) )AK00) 0 S  0 S000) 0P 0CPQ p)>R 0CRQ<0 0 S 0 S l P ,ЍG-`p0M @0      0 " R d1R P j h400) R0 L 0000)0P P(1S 1SH1 + 1@(P 0  003SP @`FV  P@`Vt0S h  000lP@``V 0 [:0S t 00) P0 Sn  0S000) T  Ѝp@-P@Rt` C!0S9 ;S  Q9 SS R$1APP (1%C QP1 P0PPQ 0S 0S4 00$0 |A?Pp A-`@0 M| p0R= 00) R N p000)V`aP 00R|P 9`P0S  00)0 S  0S000)h Ѝ0@-P@R0@I0 S0 0  0 0   0 0   0 0 00 0 0S 0 0 0\0dp@-P$M@  00)0 @0! 0 0#` ' )0; )00)V 1  9S  99(1S. $1+ 0  0d 04S0   04 04S  P %1R0%1 00%1( 9(90S 0S $ЍpA-p@$MPPX  00 0 0 3R`0  0  03Q0 Č 000 0  03Q0 Č 000 0  03Q0 Č 000 0  0 3R  I^ 0$ 0 3R`  7\  0S  v0S $Ѝ0@-@<0 P 03P1 0" 0003^A 0" 0003^ 0" 0003^ 0"  0003Q00 0  003S ^ 0p@-;S )RpPP0a^ ' `@!03 0SL0^ pp@-@MP$1U`  V * 0lV Ѝpp@-P@Q1S(;B0CVSj8 ( L H $ 0 0 3R :\ p p@e p@a p@]p@ p@V p@R p@NPT @ ` l $10$1X$1 0$1p !0!0S )ppPT :T 00S 0S <0 `0`3V|0Sp1  <0 0003S p$ 0d1  A? R0 <0 Rp$ 0 0 3RP eJ1S1S p<0 0003S 00P7S $1t(!0$1%o$10$1k<0  03\!0 500p<0 0003SP1 Q+% ppQp@-P@` 0 0 3R  ^ 0Op pp@-@P 0 1R:p0bT@!a, 003Q  ^ 0Op po-8 M0 1R *0b\00oЍ-, :#:Sx 01\* 0  0 0001\* 0  1910  C0 mP oA-`p0P0@U*0eW@1@!, 003Q P`pd xP   o-0M0Q:o0aR 0 03Ѝp@-P@`, 003Q p0NS T0\ 00R@0NS \e 0@pp@-P`, 0@03Q p0NS X0T0 S @0NS T e0@pG-M R  <0 0 3R0  P:0iJ$J 0  003S `P  `0 d~ 堢p@ 0)0!0S0!C)AK ^sP5 0@ S+0@fT@!2Z<1   k -l2ZP0 0`pW4 X 0S.1+  0 )  )AsKʠ 0 0 3R )\ 0S 4 zW*  0 C Pm 0)0!00!) AIKP . 0` ! 0 0 3R  0` P Ѝ- 1 0 C kP 0 p@-`PS S 0`p 0@pp, X18 0<0Q-*00CS  8   , 0 00 0|0 0t0 0 l0 0 d0 0\0 0T0 0 0S 0S X 44 -(P $C)HĎHȎ@-pM1` (@f P@ ^`VGЍ@-@@@-x0x@| Rh0/RTL 404 ,0 XH(8P0@- 4PA0S0P 00XP0@- 0PA0S 0P 00@-@@D@Tg0@pp`L0p` `f h00Q0rV%q,40000`!aP%,3  ,  00AP%, <P%,0, !P%" P% 11#0E- `0L \ppPL0pP Pegh000A400zE$r  Q00!pq@$3     Q00 @$  4Q@$  0 !@$"@$ 11# 0P@ U8* 050  0c ba0S0c R bQaS0S00:#:#$"""! 0 `"1  """$00 S0:00S$O3L3@RU3- 0 R l( e8 R-0Q ,WXp@-PU 4`A0S0S ,CpE-P@?``V 04H " ""?T0@Z`P @p'VV0.0 0, ;V 0,0 0,0#=0p@l!` OV0 0 0 0 0 0 0 yZnܼbG-AYM 00 S:0 0 R1C00w000S<242 00Rg @1!p`0  p@@`VZ` p PA` `0V0#0 P V%X% `0 V `#RY/P , 003Q  n `V 00"H#EgܺvT2ô  e \ f h0S , 0S 0S`1 RUHYߍ0 0bG- <0pPR@ M`  Oꀠ1/t00)  `R  000)0S'1 00 04 PU 01U 1 !R 0  00)0 S  0S000)Y 0<Y   Ѝ0- ,0-RS 0PAAG-0 pHM0pd0DA`1P⌠  PE@DvtW @W@1@@#, 003Q p @T 00 X00 0400 0}ipHЍ@-pR$ 2R 0R  |2R p2R d2RG  T2,  0003S^ <0X!P& 0 <0R 0  003S 00^!0aP5: P0 S0:00S\0T0<0X!P& 0 <0R @ 1 000 3R@Tg 0  003S00\Y  @0003Q0 0RJP6P0  003S8 \ R@RRR@R(<0X!P& 0 <0Rt @ 0  003S@``TV  0 0 3R  P 0P; V :0 00 S0:00S&U0R0, X16 0<0Q$ 0P 0, X16 0<0Q G-M 0*00)0莠 0'0 0* 0霠0(0  0'0ꪠ0)0 0( P0pv 0*00) 0莠 0'00*`@(Ÿ0霠0(0 0'0ꪠ0)0 0(0pv  0' 0 0  莠  0( 0  靠  0)0  ꫠ  0*0  py  0' 0 0  莠 0( 0 0  靠  0)0 0  ꫠ 0*0  py 0' 0#0 莠 0( 0#0雠 0)0# 0ꪠ 0*0#0px 0' 0# 0莠 0( 0#0雠 0)0#  0ꪠ 0* 0#0pxyZnЍE-p("h8#XM @ R 0@0bKS 0$0/0p d@?2c<0T0( p  2b3c!NЍG-("8#h@gM ĠR 00@ HP <p000 h` 0L@1@1 L(000 01`0L1gߍG-P8#h^fM ,K-  H Dp0h `0H0!0Pc1%,C1@T*H HH 0! `00d0H`fߍ 000ap@-@0L `S -@00)xP-T h V0`00B00$4@0 @ 000,00)p4aC@RG-MP@ WP , 1 S 3 A? R0 <0 R 3 T1`p$ Cd3T ( 0CT  0CTv 0CT 0T 3Tx 0T 3T0CT4*2T 0CT  2T 2T  TrT *=2TZ :0T; 0CTC |x2T  0CT 0CT0CT *0CT 0T g(2T T@*2T9 20CT X1T 0CT7 V T 0CTU J1Te 0T C1T$ 0CT 0T 81T J:0T 0Z# U XAPH1Z" 44%(ƒAQ .00Z U    P0 0R P0^Uh}hl0 bQcKp~EK2K=KAKDKKKIKHKNKrKlKkKpKVV V V4$ 5p Z U    0440 044004040/oE0S 0P P PU U +0 #100 #100#- x0@  0  003SJG` 00p 0 3R \3T 0T 0k`P  0  003S``ZQ 0j`K 0, 0 3Rp \2-S2T 0T' ",0P -00 Q*"  d2 RT2Q 0@  0@3T.$0 Z ,0"0S,0!SPo  1Rj㖅!00C0c1 Q1 Ru00Sq0SP L!,0PP#H!0@S X1 0<0P  :P ,0 ̠ 0Q00000 " Q 0\ Q X16 0 <0 R 0 0*" ,Q,4S 0#4SnLKFKd3~d7h~ 0Ϡ 0 3R8 \T88  T* 83pQ0CU P  p 0003Q@T00SP 0 03PUB 0SJ=Z/ `VQ|BŸp0 P0b 1S `V1S VQP<@⫿W@ ᦿ` ZV 0 eය 0S 00 RW P00j0W|0L0b 0T@T_P$ W P01U a R Q 00c00 R\ a` p R ʜQ 00c0 00 Rdl0P T KLD<0 @0j00b0 <Aھ 888 8h7 0003Q|2  Rd2 0  003S@Zi  0  003S QR1 0 0 3R ۼ "10"ZB w@K %" 0x7 96:02m  0  003S2Z/ $mZ  E U00?RP0\  PZ   0$@ 0 3R ᏼ^$0S0  \00 00D0 0  0 3RRL@<de\~`~5 0  003S @@10  003S ,#0 08##<0cP 1S 1S@8#0S0>T0S 0   03^!$0 "P0@1S 1S @>TP01S 1S>T0Z E>P7PR@P1P建kZo E>QwytZf 1 R`VU00S00R@PpA00000C0CUR??UMU@ aP01S 1S 0 T 0 T S@>T"0P PE1S 1S0 U 0 U!U S Z 0  003S @@i0  003S 0 p }dex 5m|8# 0  03Q0 00!Z 0  003S @@70  003S0 8# 0  03Q0 Č 008# 0  03Q0 008# 0  03Q0 008#x 0  03Q 0 008#h 0   03Q 0 00P8#X3@@W Y  Y j~ VU Z t Z m WT(3@W 3p  >0QFZ8 81<0"18@0D 80!800< @0"0D0\ Z Z 66p lK~Zp @ 0` 0 3R @T j1S 0  0 3R` ۹\Q 0 10 3Q F1T 0TZ2 0 8 0 10 A? R0 <0 R p 00\0 A? R0 <0 R 0 0p fKQ ߍ@-L@0pPM @000) R  000)`P(p &00 W 0@S 00)0 S  0S000) Ѝ0@-@P\\ 0 @000@0 @ @0@ @  0 0@c5p~p@-P0@|0 !`VO1 R:!P 1V P}b bp@'p 5t (p@- @0PT 0 ROP l 01`\  !P0!@p0!Q pp  50@-P2@L0@@DdOP0(0!2 00p |@-p`P@T T T Po P`VVU0`G-lŸM0` 0@P*00P  00)  000)Y2  0I0 OP00)  B Q000)Q !000 wV0æ?S 00)H1  B Q000)Q 000!0f !Z! 0U08  cpp JR0g` , @ 0P  0P3U    c0pW  cp` 0JShenp |V0 0  cZ <0 J 0003Q00`0Z0V0S`F?@pZ*  ic JP<0 @0@3T   ~c `0pW  Hcp/0g`Z$\P 0@  0@3T     [c  0J0pW  !cp`ZZ P<0 @0@3T 5c0 0c0O  )D 00C0 R  000)R 000nheЍG-pŸM0P 0@*00`00)  000)Xp2  0H0MP00),  B Q000)Q !000+!U0å?S 00)1  B Q000)Q t000 0ed!Z!1 p0V07 vb`Z0fP , Jp 0  003S@@ @b b`V Ib `PZU&@SbZ Jp 0  003S henp |  P0Z0U0S0S:bPE?@Ỿ`Z1   b% J<0 p0003S@@ @b 'bP`V a`/0fPZ%L@ 0  03Q0 00 !apJ`V a `PZZ <0 p0003S@@ @a a0S  c }I 0c0O  )D 00C0 R  000)R 000nheЍ-2 @\LP$$ @-K@P 2,A-x0Qt a@PU {PP ,@0# P*0S@ŗ@Th 0 ph \#!1 R $0 P  p@-P`DpLP 1@TT  `P>U|- 0P  0 3R  00PhA-P 0p  0 3R @@ HpH` 0 0S0@Th|p 0@- 0dP  0 3R @@ 000 @Tڈ0h0@- 0`P  0 3R  00@ 0#0@\0hA- 0pW00`㈀QU @P D{@T?{01`V`PAP 3{P`Vl@-@0!1@T 00CS0{|G-M -KPH 1 !p W00WQ< 0R8`P@@TP1S P Q P TX 1`PVU U00V0S X 0000! pv z|>YЍE-MpA!(`"VP z`P 0| 0SZ(3@QU  z0PS 1  Q?00ᵠ : p@-0a!@T 0S pT  LR  yPPT 000 p~00!P$0T  p|lG-2M 1`0! 0S R 0S0 pPv 10 0 0 \ QU @ 0d!S   _pP@@08#?TXZ ! 0Q00 0A8#8"S0 @ 0!0 $( "(-P`  0A8#8$S 0 P  0000 !}y |l  ZЍG-4!41 \ 1` V000!V 00CS0 Oy P P1娐`0@pT X%(P@TPUjP 1 80 P IPU0 `l|hhp@-Pl0AaIP 1Qp1 R (!000!p|G-P0Mp! P3  0Z) 0% @T ` 30 S0p S ..,0 ! 0P@`?V0S R(" ",0  W |Ѝ0!P|Q 0AS:A 0CQS?0 S 1P5P A30P ?00 P0@-@8PHP 1!Q@>T0|@-tt t@ 000d< 0 00 D0  80d0@塽$ppq@RtR, A-0@`M p C -L+H00)  pR  000) P p 0 0SQ 0  003SP 00)0 S  0S000)ЍG-`@RM- L3R] 0CR# 0R -$3RN 0R' & 3R 3R 2RJ 2RC 2R 2R  2 4@B0+ ^000%"0@S  X14 0<0\ DŸ0 d000B0"000@\, 0$03Q8 -XY@@ $R1 cf(Đ0@-P(AT 1  0S EÅ0G-p`(Q@U $1 X GTQ = )  R C)AKW' TK, 003Q  ᘬ @T T@P p`d  0V V@@T 0)0!00!) AzK P 0-(!R $1 @-@(P 0S1S  P- 1!0b, 0003S- <0 0003S 00\ S EêEP-$<)0R 1T@P-,*) 0R 0 0T0@-P(AT 0S $1  %10%10@-P (Q !1c\E1` QY1E/` AT ᗨ[!0>0000G-LLCM)& ,Sp! 3 # ̠q0 b삟좟쒟00$Ÿ0@02p p(pDPT\0Ÿ2dht0Ÿ2Ÿ XL``x0xx2x"Hpq0 HH"H000$0P TXL@\P z&@P t&@1!p|0Y(aܑ X >0H  P01 0T PL00E 00dT00XX 00\0H 444 T01 0P1P 1L0 000X 00@@ \ |0P & P, &1`5T0<D!l $g h |j \l j Lh \m @L-%)TtQk `769=AEIMl ⼀pPˌ^PtЍE-Pp\0` @T 0@@ S 0f @PTUUE00,0(E-p0 M P 0*` PU 0SU @ |0?L PU 0S  PU 0SU 0S 0 0S ,4Ѝ- 0S0S 0S @lQJ1 S2Q?Q0 0 1 00 0 Y,- R 0S 0L>S    01 0Y@-\@ ^P0PH000Yg , iP  'H Yq @P@-,0 $AVU!9||0@-HP@@4>0s (0  0 l =000|Y- , 003Q  ዩ^ G-`B MPR-SUc <0  0 3R PP 0  003S0@ 8# 0  03Q0@ D008#x 0  03Q0 008# 0  03Q0@ D008#H 000 3R0008#걀pᵠ@Ṑ0H8# G("x0J8#D !H 0  B("(X!0C8#8Wp!Z!T@!Y07% $&2KZDP    0;D?p |U0P`C 0R 0ß0Y jx x z \z p\d P8 40  ᠵP PJX  P X10 2  PRp  p0@ yP+ `X  P#X10 2 $B 0 @ [`W@@`pD<< W5ڬ!@0P @ᢰP ᝰPPU#y P``q P00@ PჰP ~P@T Z Pp0s  j0 0Z@ Wq | bh g0#<#d0W0Z 0,@  j<0 a < |p |Y,  jP 0;@p`mPP % /|Y|0pP EnP@0`T Pp ` 0@ ៴PV P 00`(0@T0 0c0Y| ЍG-l`p MP@I9Q00) R  P000)t 0``S) \ 0PS$00! 0@hT@ 00S 0S00)0 S  0 S000) 0 Ѝp@-@T pP 00R00Ō^$0|||`00` k000 0@ 00@R0C0`00ppq00@-P pp@00x0P0 0C @00C@@0<0CP0 @$0pq̒P0S00Ň <<0 000 00H0C 0pq- #A-P@Tp@k R O㑡JጡP@TE-P`@ =U{ 5wn 0P`+m@TA-@`0P0)p  (mjRV H[X000), pAN@-`p0@0)P  =:"z P,)000)  @-@     @@-@  @-S@M P , 0  03Q \ Ѝp@-P@S0EM SԄ ą h Ԅ ą h \ <0X!& 0 <0R SU  0  003S 00Q0E P0C0 0  0 3RP ᒥ\00  p `TU 0 <0 0003S, 0 03Q Ⴄ\k j =0WU , 0003S(%<0 0003S!0: S  <0 0003S\ -<0X!& 0 <0R  0  003S Q0@0)R000)mЍp@-p MP @ ``  0 @  00 : S 0 m8pl 0奩t,Ѝ@-`M@ _ P0p: S@m @00 H00P A @nꌓЍp@- M   Pg`@`@N<0@hGx+@P:d \0P P000H!F *, 0@: S`Y ԓm! `00L0H  A0 @\! Ѝp0@-l@0P S 0^0@ 00R  1S!0P0LYP- D0 0C0$ 0S QZLY@-`8P@p!0S0S @TLY@-X@X0 Q 00 奨(0 00@,Y@0@-X@0TPS 0@@ 00000(0 000@Y @R0@-@PPPq, 0 03Q  ᙢ\ 0,Y@-000@M 40P  P 0,,0"P   I4 DؔЍ@-@-<0 0003S\ @-@P`U*|p  0  003SQ P0@U:\I-$G P@ L -0LZ-(0  00bS 0*@RLZp@-@P0`S V P 0SP 0Sp0@-@PU0P5 P0 P+ P& P! P P xP hP X0U PP @P0\<TDL$,4G-P`PM=p1S"  [0@ `T SP`0P, NhP\ U (@TpW:h`P* X ٠U0\00000S 0 SSpPZd pWQ  0`0``0P```?H01H RH@888D @-0$@"1A  00 8 -2 1!R  |9T0  1SQ,00A?0SQG-T >T!0$ 21 1A/00 <  1S1 000  (H0SL0S LP ,1 0A/000?0$ O0\ A?  C? ;<S AO0S P" <S AOܟ0  Q:p 80 ZZZZZܡ C? C/008#800A?@ ! P  0Q0 OS 0:* @J T * 2R@ T*0S T: \3 0Q3XP + #0 0P0! BPr2  Br0 @e0`V P  ᓏ`0P0@V @ T!  0a P@`L2 `bV@h `FtV R2  00, 000 0 2Aq Aq0$Q   00Ao Pᴝ@P  @T*00C0 0R@00@0+w," P 01 0100 0 @02 0 1<!00S 00 R020C0$ 000R?0S0S ( 0(Z  1 R1 @T 0 0S  (' R @  0   Ď  ,$00 000@X 0S h h004X(0QH@0S <0  P 00!  5ZT p Z0 Z 00Z,ЍG-Pp0 M,€ a\1 RXYXU .U0R .W 0R0 000 @bU%*00CS!:  0nR 0@e 0 d@4P @ eT 8` \ X  D0 0@ nR P 00\  ЍA-p`M@^0 R)0!Q$>S>Sh0h ``` P @0 0PdS0 V  008` 5\ X ЍA-pP`M@ ^0 R.0!Q)>S .P0Rp0p PPPd 00 aS0  00U  008` 5\ X ЍG-`p00"1Q 1 `R 0 R`#*1 R  Ԁ0S rẮ\>@~.0dS 0.,0R > S !0 V S00R7 00S 0.@ 0dR rV㺮~ V V 0S D0.@ 0dR $ 00 08Z` X \ 0@-0 R# P0S 0CS0t 0p1 @T T0. 0l R ,, 00#00` \ p 8X ZG-0Ÿ$M0@2 @@P^  h",P0`0`0"L2@^*<2\ *0"00n\-*l 00`&0S#:\!* 0 l00`^ 1\ :!00a\ @@ x0 S\000\ D0 pW pPEu  `PE P @ 000尀<P W0  f0 @@P @n\`0X!W  `f` 0P@@P @n\0`ZZZZZZ`pW:W  0f 0@P@ d\h 0 SP000H@ ^ W 0pW p PuZZZs$ЍG-$M  "D@p  C0r㄀y `  0 B 00 <R X 0 f0 0c0A/0 @@ 0<0| 0 0S0 0 Pj@\ 0 @@ n@ C/0@   0Pj8` 5ZZZZZT  |  L 0i  0aRd0S\ PU\ j0#RXY   @ 0@b0 00 0nS P@0P@.0 a0b0A/0 @@ 0<0|0 0S  "0 0S0 1 Pj@\ 0 @@ n@UC/0@  0@ j@FPj  0P 0i0j0 `j P@ eR  02"Aq AqC? Z!  BR  |  P 0P`@i j@ @0 |   0i@j"T*^  @0jPe@<0 j   >00A/0 @@ 0<0|"00jSdC/0@   0s0i 0n bR]Q\  RU j0#RQ0^  0jP@e@b00j 0 0 0P00l@.0 a00A/0 @@ 0<0|0 0S  H!00jS0@41Y@  0G C/0@  0@ j@8   0-0j L0i0j@ll 0 P@ eR  02"Aq Aq  ЍG-P`pM48€ A<\0 R-XZ* >U0Q.V 0R W 0Q.Y 0R k,0 0 l  8` ЍG-Pp`M<0 U*4 0 S @eV  V4*4 0 S0 @fV 80@ 4 d80 ,4 d80  80@ H408 0@dQ 0dSP 0ЍG-P p0"S1!A 1 䡟0`S V1!  0!! 1 `R 1!40Q8 0R04000C? 0 R R 0 0b0  00C!S00Y0  x0S  0 \ 0! R 0s x@00 40,!80 C  |Z80 ZZZZZT |Z|   5p G-`@QM0\"1QpYQ밭ZMTF 0S \I  0 !B >0嶒 0plX0 2 n\ @ 0 0 g l@ P dR   n\ @ 0嶒8Ѝ@-@1S R 00CS0@O001G-@`QM$ p V 0S DO2 1PP3 R ZA? W 001SV @a 000"A?pᲠ" P00R0S+ 02 0@ 2021"0C1! B!0@O 0P@P,000ʶ<  "9R P6<2 0@ 2021!0 1<!0 @\l0@ ,00L\ʞ0@ <  "0102Q{  !0000/ጕP` ᆕ@႕T*00C0C? 4<S AOr0S jP <S AO` 0  Q: 8ZC? C/008#800@ ܓ 0r1 R,H@0S( <0 ˓P 00!  00Z0 ZZ 1Pd0!@T 0 0S  RY 00CS0 IN5ЍG-p(M0尐S `   R  V  0I 21!AϠ000! 01PQ<<U0k`V@* ᫄ T  d P0`V:V 2114\ R, 0 03Q  Q^ 70'0(P0 0 0   0& 21 @x`TQP T 21 0R 0A/00 0 1998%(ЍG- M0P@21a =S0 R 0@pppp0l   0@T0$  R028`  ZZZ000000 Ѝ@-@0 PPxp0S `SPc000  P: 00lp ZZZZG-`pM0W:0W*@`@ና%P0 @Q0 P0h40 Q,0 R( @P儠PePhP0@W*P0 `P0h P$0 0 P p ZZZZZPY0SPЍ-B~0@0;#2 Sh00*"2P00*"22040 \,0(0 \N~ZZZG-Ÿ2"M^ 21qX 0 Sl2 !P00QP@2 R:42404 R8 0R4"0 S'` 0V@0%0T 1 T1@ @bPb0`Vp!0T0l1 @ZP00 K  Df01 R%b 1P `R 10R00SQ P0 RJ0 ! R00Q0S?C? 0 R Rc R0< 0 b<0P Zp 85T |ZZZZ|   ` 0l PA? @@ |0SЍ-$0Q 0 R$Z` G-HM0 "1180, 4 0 Q00  84 ^00R0SRQ 4R00RPSPQ4 R Qpp D2DŸD 0444"  @T)PdUP^0(a 0400 $ ^0 408 x0 0@T4^l(d4 `1R(8000(0S 80$XS 8$4 X0 Sz40 ,8pS8R6S0(`,00<#$P5% Q:9' @T1@T230 `O^O\Fp 8š nn4$0@SX30S0`c,00 <#$P5%@T "" :9'1@T230@ T  :9'1@T230 `'^O\0St80Sp<@ 40x^0qE(`88 0$0C0P#0, 0 B8 80< Q#0CR #@ @,00<#$P5%0 C R 0b1C@ 0L 0Y 0i2 0Ll  Z 0j2W0 @T1@T130 `O^O\4 R80S(`,00<#$OP0^0ZO\WQ$8 0X0CQ:8000(0S Y 8A?O#꾸jš HЍP@-@ P P  @葀, 0 03Q @X, 0 03Q l@-P`p0@S9 P I P IP IP IV000 000( I0S0 I0S 0  IP W IPp@P) E-p0Qca 0@l0nT@!T"@ 0`P  i 0   b 0  [ R Q  0PG-$Mp `P@ 0ZZ0YU* 0 00  00 PG0S 10T100<0  03P"0"  0003P!0"  0003P!0" T 0003P!0" p`PT@@0Y:$ЍG-Mp `P@ 0Yr0Pl*X T 00H 0 0 3R0 008#8 0 000 3R0Č 008#80 000 3R0Č 008#ȠT 0  03Q0 008#80p`PT@@0 0     P0^:Ѝ R$R0R     @-A0P00 0 0 0@0P00 0 0 0@0P00 0 0 0`@``0P00 0 0 0   $ , 4 < L \ l   H R<0 P1SP@A-Ppl@` 0T*0S ( H"?P@8 U00T0#SUE0088G-DMp*Q0`Z D0S* @ 0D \@C @, 003Q -\Po@08 DЍG-DMp*Q0`X D0S+ @n 0D \@C @, 003Q ˀ\ Po@08 DЍG-PpT00T09 T0P0T0@`H0 R 80 R Eo@>T8@8G-! M `V | !q !00 Po00@!41<BAAP`D 1 aAϠ 00开ᶠ0徐0E/0}  00A/<ᲀᶠ᳐ 0pt Rt0t0t0S H01H RH R# H0 S @888|999E>P R 0S0H ?P0H0 Ѝ@- M @!ꈢЍG-pCM*ß堒 a@0PXR FR8D1 0 0 3R ~\ J, 003Q` ~^ 60?S2 P 1St 1S#P @(@@">T0S  @88)  0` Cߍ@-M *0L!2a0pPWO $0S   F@ 0  0.,0 S:0b @,0  `0S :#: . . 0@N,0S :#:S, 0 00#P 8Ѝ0@-*0@PA R& R 00008-*0 2!008G-0`SPԠԐ 00R  PU1S2!<2`P@|p0S00@>T000S <0<<< 0)&, 8[| @84  8 < - (0\0S  >R@ 0S 0 0 0C0@88, p@-@ )0P000 9\P tl @0`TXP0@T@0@P 0S @ p萢T[P@ L4[@@G-MP 0S  cP  0S  LB 0KSkS5 0  0,S00 CP' 0S @P0SP P0 BR000 c @>Tڂ0p0  00s\ `P @08QS  @0S`00-S 0@0` 0SJ @̠` ~P ~pP*0:S&~P  R 0pD!0000S% 긢0 Ģ@84[̢4 8 < L@Т `@ @, `p ^ 0PU `@D Ѝ0S0000G-P`A? (p$ UZW0 6 "L| L| 0 0 0 0 0 0 0 0 0 G-@A? M PP0兑  2!S20^$0 S! "0 P8 $ xAQ\0 0Ca` V0N00SpP0 S0a\ 0 0!!l8 T$ (LY0 0CApTL0P`P  0S Ѝ 00 G- P^U# Y 01&<% U *\ B0 \ 0\q "@N0\0\00SU/ 01 @GP0! R |p@-`A0 P  R0 0`01 A?10 000 0 2S0@;w<20""00 0  0p|T td G->XqԠP0 S.K.`P  >`00!Qᳵ0.@PK0H0 @@0@ 000 0|5G-QM$pP(00! $ P 0! ($ 0  pW /40AOPa |00$ \0 Q00.P@T*4PP /@T: p |@( pWX (0pW4,1` R P 0   00$000  0 X! \  0P@ h * 0lC$:0 T* geZ 0   B0r2  Br00@ PT: \  `  B0r2  Br0 0 ./ 00000 00040 080,0 K@T f 00001GO, PR \0P 0!Qp( WR|aލp@-PdP L`A0 0 .U K.00p|Q0@-@ 0P,0 1@0PQ:0C,0, 020 4800\00\ 0C00000 .#,00 0000|00 40 |40P (0! 00`0fp | de40P (0! 000ep | de0@-@p P080\ 40 00CP*00  !0000|0@-@d 040PQ8 0Q 0A00 0 0a0!0000|E-PU M- U tUL q! `0!0lp@ TR00,@ n  00P@0n0C@ 9!`0!0l0p ^*@00  00,@ |!`0ᄀ@!\  0@ ! B0r2  Br0 000|Ѝ@-^M ^ Q^) N!`0pP!,@l^0 0!L`0p, PB@Q 00@ |!`0p@,!PA^ 00@ @0p2 @p0 000|Ѝp@-Q@M`0, 0b\ P1P!10Cs" 0Cs A 1P0, 0P  000|Ѝp-T0000 000000000 00|E-@ß0@ Z p`0 D0 1R񟗿|؅LĆĆ(\Q!0Q000!0Q 00!0Q00!0Q 00!0Q@000Q0 0000 ۯ0 0000Q00a̯0 0000Q00R!0Q000K!0Q00E!0Q00?!0Q009 0 0  0Q00, 0 0  0Q00Q 0 0  D0QAPd0  (AQ<0  " 0@ ZE| p@-@0`S T! RP1 T!L!P1L!0SMcP^ 0 0)0P000)p@sc de0@-PD0(M @0 0 40 ,00i|4(Ѝ00@-P!00 , M@0!00 }iP Ѝ00 1 p |G-r0`@ ZPB0o D0 1SD S S S S/ SK ;:SL SP V 0 0"!  s0 0"! m0U000j "20Se U000 0V%X 0U 000N0U@000HV 0 0"!  <0 0"! 69 V  0U000/V9  =39'D0 1S S S 0U0000U000V 0 0"!  0 0"! 3=0 p0@ Z\|p~0@-$@!D0P0C S񟗀 T؎؎؎؎؎̍$h0@m H Rj1 0 c 0@0@[ H RXd1 ! 0 Q 002 S0001H 1<R< #!!"b" 0@) @0S H000000@0S H }R*0! 0 000A0HP @P 0TH P B 0@b1H 80<R< #!!"b" 0| h x del 0@-(PA008 ! 0000|0@-(PA008  0000|, 1, bQQ |, 10 bQQ |, 1, bQQ '|, 10 bQQ |- ,000000 #10)'  0"" R000 0" R000 0"# R0000 R000 0000 00|p@-`(AQ0  0'  010 0  R000 0"! R 000 0! R@000 00S   00 00000PܬA0R 000p|E-HRA0`4` 080(2<0 p000弬0 `0 000000 9=9000 `000 000000 0000@00 00080000 #100#- 0##10- 0##10- 0##10- ` 0 `0"0: 0`0 22p00 00000L00 00 W  |Ęp~de Rp@-`b R$ R R R. OR Rn \R| R R{ R{ } 2Q~ 1p ,0Ss 00C0 ,00C,0000p @1` ,0P0C0 0,0CQ *0,0 ,0 03 0, p11 >  ,00C00 , PA000 ᷫ0 000pPA000 ᦫ0 000p@0H < p,08 00 0 ;;8 ,010-c*c'!0<0!0<0!0<0p 0 #10P 0 #100#- |ĘHئDp~PR0@-@ RR! " @@@0P@ R @0D 1@@0 0@00@Q 0@0(0<0j 0 < 0|\ĘA-0pLA0LS Wa0LS>9\@ P@0Da0@00 7 C   @0S-DH0 200L 00 P0 200T 00 X0 200\ 00w  0<00 < |ĘE-`pP@p0@ @P @0D 1@0 0@00@Q 0@ [U< 0?U000 0  0<0|$-;^!@0S0@000N S1` <  @D 0100@ D!000C00|Lp@-@PlU`3 <0 hU nU p 0DP<P@1  00p@0E5Sꈤ8dġ, Ԣt 0`dPXd D0S0CD0 0D0  D0S0D0 00D ,; D0S0D0 00D ,# D0S0D0 0,D0  D0S0D0 0,D0 a D0S0D0 00D  D0S0D0 00D  b D0S0CD0 0, D0S0CD0 H0S0CH0 0HD x 0D@s 0Dn 0D*i 0DAd|Ę@ 0D+\ 0D RXdQtd<0 0003S 0S 00d -TT0T 0S!0(S0(|d p  0 00coA-||1p @RWP TaQ0<0S  (000A0 `R 000^ 000 0 0  0 00xP0<0S  (0P00 H0Q 0(p ` |5l oܿ@Rcd p@-`0S( P Pp@0  \ tt0 0 0 X0@@0(P ?p` p <oh @Rc|X@-@0 0S d0 R XX X00D0P , 0 00cp 5` o@Rh -,0 Q0 05| E-PL@rbQ+  0  003S 0 0 000 3R0 00 000 3R0 00! 0  003S 000  003S 000  003S 00p`PUQ$ PNPp xpt@d`^ 0 0  0 0  0 0 lP>U ,! |-p-lA-@P```p``@T0 0 0 0 0 0 A<|  ,!G-p3MA 0P S0 SA X   R 0S(0S p @`^*0H, 000 3R00P0S ^:@DTpp @ R 0 S 0!2 ZÝ S 10, 0S P  X  0 0 3R  T^ pm(a0$A0000)  000) 00,p00)  B Q000)Q 0000WX0;S01" 0\p0S 0Q 0RQ p 5|hen0 S R RpW^ , 0 03Q  S\ pY Ѝ0@-H @0H0PS01" 0|R-@0! ,0 H0S0 |0, 00  |@-@0 {@ (0!Q 0s|pe-$1R 00|pe -AP~0@-H$XU0@J U*$ E?0@A$>$ ?:?0@60 R h0m0 R q0m0  0Redep@-PQ``M₎$0$Q 0 1eep 0|0 R )R 0\ \!0 0S@@T  ^P  p p~!ЍpE-@P00Spp` B00iRP` oRT00d"T"0@VS W 800N0(("0RTU"V0001 R Vr1! 0E{lVW P0 0S !x!0 00ᄿ0 @Tpp0S 0 ? ,1Q; 1 |P2!0 0# #1S&  DT0@W 0S4 T0@ 0"1S0 T 00VW00!ee!D"de\ e@T~e@R!!X~d3!@0 BR $1 R0 xeeX~p@-@\" T! RP1 T!L!P1L!@MQP^D` 0 0)0P000)@RP @p@cPp x dep@-L0 @P@`@0T ?T@9P @p@JPp x de@-\! T!p RP1 T!pL!P1L!@MtPP^@` 0 0)0P000) Pe de  00e@-(@P 0 zP00\~`~-0x 0ep 5-P,0   BRP 0!!eꤥ0@-@ 0P0S  0S @0e0ee 0\"@-@0Se0@- 00@\ *Pd 1S0S  \: T T00.0e@<-0Ox de-0PD80@-@RH1 P 41 R(1 0@k0 2T/0@0@#0G!0@480 T0  0!xeh"d"- 0 0 !l"0@-1 1R@P=P ^ 0 #10') ^ 0Q0A0 0000S 0 00 00^ 0S T0@p 80  R`000eX~!xe!E- 0 Q㘠1`S Pxxph@h!03 0 *"B4S0S0   \ZQxeX~ed,@-@ ,0 @ @! P  0@ 0s#0!$0 R 0 0#0e!$0 R 0 0#0e!0p"00$ 88080 6Nede@-QP@0D1  0  080p~ep@-@1@ P! `\ 1 "\!0 0 0 0  0 0 0 @R 0s |0Q0l00\ 10 L 0T @<0 R pp p~eee!ee!p"0m0@-4ll0lP R\0\ P0S dD D0 00< @@00:0M00mp~he}e n\nde00)8  0 8 34 000)00)d R X0S 8 0 8 34 000)G-3MQ UO 0 SL 0_24  q p0@0`0T!4 RcL!000P!00 H  $00$0  000 0000 00 0 0 dX80000 P1  u  P!0 P!000 T1 S 0T1PL!0 P10L!0P1L!0P1T1 L!0T10_24  u0o24@ 0  000 000 00 0 00000    x0 0S P j 06  $1' 0 0$18  8 @0l0@0LPh@D` 00) h @000)L`g@|"de0$1 80#$08000 P , R 04  @00@0,Cd0S90$!5` X0 ` `0:#:`0@  @ d00CSd0L\S@0l0@0zLPh@` 00) h @000)h&Ld0S 80#$0800 0  S034   0D0|"de@RЍ0@-h0S 0 0)@000)T P0  @PT0|"@-@T @LP 1  0S G-p`0 0bS:P1S @@00) V000)PU0 /0 000 R @@00) ;000)(0 00C0`go@R4,cgX0 PRH0$0 SRP?\0   `gpgA-p@M`RPP EKU ' 00) R 0S 0S Q ENK$ X0S XP0 ß 1 034 0#$0034 #$0 R0 34 00! 0 34 0_24 R, X16 0<0Q Q EJp RP' !R 0S!Rp 0hd2"#ɎpP , X16 0<0Q Q EJppp 01S0@ 0A /0o"$40 c0JbT@T@Tʼ 0)0!00!)AGK)  )d0>c\0JlT@T@TX F\0d 0:#: \0d 000)`pdi(,000)d0S $18 0 8 34 Ѝ9d`P9d@-@)00)`\d000)㏶1  0S  Q, 80#$08000@-@!0Y  1 R<00<000)<0O24   )00@-P!0I  ,0S 0,01 R<00<000)<0O24   )0p@-PQD⚩ =P !T E:00`F0v@4pd'`@ i@deL@-( 0@0)000)T~G-`ㄐ儀p_ 0 0^J6PUP呸0@T0S 0`FS@@@x0@-@P P 00l(0 0C Rd@-d@p @T@-OP6@T0@-P0@0)} P000)0d0@-P0@0)n P000)0`0@-P0@0)_$ `00[ P000)0d`-UPPP P PP P `e @PLP8$0Pī$D`x@-`X@ McD0 R P ,嶷a0 00}ꌬl.Ѝp@- P`0@0)l 00` Z00P0  0C   8`㍷?5PU000)pd`0@-P0@0)$ 00 P000)0d`0@-P0@0)8 00,, 0P00000)0d@`-00)0 0 ** 00 0) i0- 0]P i@- < 0@CT@e0|@ i0@-lP00S0MP0 H0 8#n|@P G@ iЬ.00C0Ѝ0G-p0P`HM @R/ 0  N00) R  @000)00 Q0Sæ 00)0 S  0S000)X ^p 0  003SPEU0QX0 S i0 e0pЍA-P0@R ` T@ @|pP 0  003S`@T0V 0 04p@-4@0 Rs nD0 RA i0@-P Xߎ0DP07e00 @@@@0000A id-1/ , - 00xIi0@-\PnL0M\ <0DL00  000`  0 0 0  R 0$4 ` H  㴠0lApЍ0G-HM0@ `lP Uh\l,0 S (@R0P ` 1Aꓟ 0h \@tl`P,@p P`S8 R>    0 @0pP0@XW@0 0 00 P@$ `0pWPV0# 0U @0h@`0 p @0P`R`Q@0P``0S0@`0  40pX 00W P @0  HЍ0@-@=  09CXcXCPp0UP!W1U 0T 09CXcGC7W@0@  0`@0舭h P 21P*0 0 ,B @ ᨭ0@-PQ P0@ , 0 ` P`` $P 2/Q0R0@ P0 P@s P0@ P0@ `P0@@`Pd 80,0'`p0S$@T(P@G 0@ Ѝ45ˠ S G-\ R /\0@M  `lV9 P @00?V 7p f? -5  00@Ps`p p  0 8PPp`p p @00@p 0.Ѝp@-DE;PoUJP% V 0T0U0S pp~UP L 000p5D "0a4  000VapAG-O ;0S M P @F/ O08P`$SP0@  00C00@ハp >ᡡ0偞=OjPp  Ѝ$%;p@-0SPo$M 0R @0D)H0'''0SR0 '0   D0 0-'!$Ѝp;PP 45S ~P&ʌ0 10 S / S S ~P45S RR0`p 0 AS0 S S?S S  P 000AA@-@`;Pa^ àpMU\E XQN20^0 ^0n03  1>0Q006!Q P c84U20n\ @0 \03  0<0P00U AU 1 A0 2 0 ABЍp@-`@;$%;Pe\#M B^  bn^^PRS:P*:$1PPU R I&D^10l^0 ^0 3  0>0P00010`&  B$^P  UL10\ 0 \0l03  1<A0Q00010  CAЍp/R- y/R- oG-P;@`V;/?"M @ P0^0\0S xU \^ nK`EATP  0SP2  `0 A%0# 540C U4p }2`PP`00@s pP` 0J 0倐C ЍA-@;PU;/?p"MP ^ R\P K\P D\P PT:P4  0SP)  0c} 0%5dV# `~00 0P@5?,RS  uЍG-P;0S M0; ? 0 \0P0R0S RP) RP 60SP  - 0c\0 5%0 /\40|00 0RPPU0b0\@0PJ50 l0R#10 0L a[0"! #10UR0b00@@L0 \@ p!0 `PVU   0`P@>LcPpu\@0 `PVU@ l 3P@ LC@/1c P0aS00S  00c0 0 # Ѝ ;E-0\M P JQG Q A =S0P8  \ %$0C0~ 0S"^ ^ <  0@ppWX N O0 0@pXp   3Ѝ;0S@-@45S;0S45S   P 00 ;0S-45S;0S45S ?S S00  P *S S  ;0S-45S;0S45S m?S S 00   P *S S  ;0S-45S;0S45S @ P 00 ;0S@-@45S;0S45S } ?S S00  P *S S  ;0S@-@45S;0S45S LH ?S S 00   P *S S  G-!:@ʠ|?pMʠ0  R \ R0\  0p0B^l PU;?U   P1p  e? w/  00@Ps`p p  0 3PPp`p p @00@p 0tЍ!:**?G-0CbFO0X@P 1R00@  !4X @00RS 000` `p0P@ZdYZ Z \ Z000 .PQ  000 AG-!:@**pRp M 0pB^b PU;00?U   0p  e? .  00@Ps`p p  0 U2PPp`p p @00@p0 Ѝ!:**?G-0CbFO0X@P 1R00@  !4X @00RS 000` `p90P@ZdYZ Z \ Z000 O.PQ  000 AG-`P&:@リ᪪?xpx p$M0Z0 0S @ ' ,0' /`P* .  00@psP` P`` RZ !JJ l$ЍA-`P&:? (M p @^  0S @  00` 0'''0$^ 0S  0 '0 0@P` J5  0+'!(ЍG-*:ʠt"ʠ\M d2\? 0 @0 0 0 pP`(`40P04+,0(4ᠫ00耔X[2Q0 0   \@+>0( 00 \  p4 ?P  <.p0  c? b,  00@Ps`p p  0 /PPp`p p @00@pPh1 P(,0  mW_` O0P0 A00@0 `R  p- ?R  -p0  ? +@00@ Pq`p  0 /PPp`p p @00@p P9 0P 0 0 @0  : 07\00@o P 0 @${ᤄ#0 P0 p @PE0L0@ ᩏpX pP0  8ЍG- p* ,M  `P !::: c0?  pP``L0P0(0$5 + 05 u $32 R0@0   Y  P   P$ 0RQv$ 0SqT"0S000@(2\ 0    L0 0@oP> Q    j0@  `R  p- ?R  ,p0  ? *@00@ Pq`p  0 p.PPp`p p @00@p 0@   "pW t`0 \ $ 0    k  hP A A@0 p0 0P  p6 ?Q  A,p0  c? g*  00@Ps`p p@  0 -PPp`p p @00@p @0@  pWA0 @,Ѝ@-p`O@TM @@IЍ@-p`O@TM @9@~ЍG-dM0@|   08@ 0$ _!:P` @T 0PpL?0#0(0\\ 0S T ^00 00 0O0 ^ TP 0  `0 0O0(P` O0\\ \0R(0 @`@P }L0ST 0 (0 @L 0g`P@s0@# 50p5j `@ UT0`DLu @5Y  T <SF?P`@P`@0 pRQ@0P``p@< 0 p 00@Ps`   p @0000SD0 L @@ @@( dЍG-xM@@P` p`0<` 4& p_` p   h ,:ʠ4`ʠd?@0#0,0^p P @00@ B\ h l0 - @P0` 6,pO_` O0-\h R @0@ !,P0@\"h``PUpp0O0 , O0pP`d ph0a`0Sp p0R ,P0@p`` Ipp蚟 0 @#+ p 5jpUh0` B`/ ( l0P@@PS h0S ?@(p(p0  p@0 x Pg?0@TSpp` `$0@s ᒐX p P`ZP Y E?  0@  0 @0`pP`X`WP@0 pp `@`w PU`XH0`(W&@0P``  P@0 p`0@0 HUT@0`p0S`P @ p@ P`00@s P`0@0@ ,( {xЍG-DM   ( pᵟ , _":,@   p 4 @PŸ ,0 0P S< 0S 48 P00  q P 4 0S  e  0P 4 0S50 40 ,0S < 0S<0 @, , @@0R` 0 @* P `5᥊u@0\40 | @ @08 @0< R4 <0R  @ 00S@@@L\-00 @ 0 Z Y 0 00 0#$!9J$B$>Ls \@0@\50@ 0 ZY @ lD(0 #!$40@  La&9J$H$`PPU`@0` @!?"A0` 40%!&p4 @` Q @00S@00@T0  Y @` 0SP @s @0@ 0,DЍ!:G-ʠʠ? \`#P`^HM@ <`  @@0S 0 <R R 0O0  \ @ 0S@0 < @<_`<"@0@ʠ@pGpp4P@ 48 O?<   b%@@00 ko0@ 0@`pWV80S40S0 0@ @`8%O140哓q1,$ @0pP`TS0  @0p X W@0 @@ 0`u pWV0DUB@0p< 00@04P8% @? '0 $00@P0,0  0 `pY0X`p0S 0@0 0 40@0 &`P? $  00@psP` P`0 4`HЍp@-!JJJ`P T00@0 &::: S00@0  pPQ   O00 pA-p(JJJ`PT00@0 &:::S 00@0  ?0Q Q  O00 WX VUQQ A-p(JJJ`PT00@0 &:::S 00@0 U ?0Q Q   O00WX VUQQ @-p`'JJJ T00@0 !::: S h00@0  VW `p O00 A-p(JJJ$`PTE?0@0 &:::S00@0   ?0Q Q  O00 WX VUQQ A-p(JJJ `PT>0@0 &:::S00@0 KF z ?0Q Q   O00WX VUQQ G-$M0 @0 ^'  O0 0  In7@T@T  p3 ?T   $p  d? "  00@Ps`p p  0 &PPp`p p @00@p $ЍG-M 0 `In>@0T㣧ʼ0^% O00?T P00^S | 000(p o$`PZeYZ Z  Z000A "PQ  000 AЍG- 4!0 p 0 80\ ?<`@P` @` P``\ 0!\' R =@?AA?R < 0@ P 0@P0 0 3L03< H0R L0R 000 APЍG-XML@p8Px09$@  `bV @H8Z < 8 O00(00P`FV0f? p&?V  p U"@Vp p0 $PPp`p@00@p0 $P1@T0/Sq  740Z`fY(? @0p&?Y 8 p "@Yp p0 #PPp`p@00@p@ 0$0.0Z@@0` O00 ^0Z(0@ 0 Z$ 0;$ @00@ R+ Q?  000  @p`Pp00@s P`pP`   !(0\p` p$00$0 00  $0AXЍG-lM`pHPT@ @ 茀89 $@ `bV$@ 98^@` O00X0  %< 0S@ @@p`00D<P@ 80RQw@ 80Srp#0 S007T3\< 8 O00 $ @0"740 @0\`fZ?`p@?Z  p 3@Zp- Z? p @00@ Pq`pp0 "PPp`p@00@p @00@0 @0w@(0`PU`X`W@0P``$!$41 R@/  ~0@ 0^`FV0f?pD?V  p Q 7@Vp1 V? F p n@00@ Pq`pAp0 !PPp`p@00@p0@@( 0@@`w PU`X`W@0P`` 0 0 0$ 0& AlЍ0@-(M@P04!Ǡ\ 5 c(Ѝ00@-(M@P04!Ǡ\ J (Ѝ0G-xMl(T`Lp50@0蘠eDP50<0"@5P77#0 `$0P L O00!<0S D O000O0  $777=<\#H D O00 (s0O0 d0(0W$7PL@0S @ 0W<0SD 0 $75(0< 0B@@ @ ` 0>p4`Pp V> B ,U,0  0 @ 0 @0p @  0X W@0  @80S40S 0 @ 0,0 P@? @P4000 00(0$  0(AxЍG-M⤠Hp8 0t0Ѐh|P8 0x0!t8P77#0 `D0  O00x0S | O00' RO00 DP78H`x0S  | O004 HXS%|@0SP0O0 p0p`pyHtdt D7<0x @|06t0S 0  D78H0Tt @0Lp`0tP$ B|p-@ @ >@Q| 0RX0?  p` P @00@00P00`Pp I@ |`8`0<0 @ d⑞l~  pP`SR?@0p0@  0X W@00```Pp`L` @ 00S@pW V\0# U!@0p@P@0 `Pp0L0 \UT@0`p0SP 0 004@0P0/RQp`0` 40  ~@ pP`ST ^0@0p P0@XW@0 p`PLps Q T!S@0@00PP` L`PpVU@0 P0S`PP0@P` 00@s 0pP`0@0@@@00`HD `@0`HAЍG-M|0 騠y 谋 P`004ß@ TK訇ph P  O000bS#  O00 0Ÿ S  O00 |t|0{S@0S 0p`p{|h0 _0S  O00|@V P0L`m0@0 h@`@xPt p|P7X?  `0ptp)p` `00@`Ppp `Q 0R0 p@ lPp`P p0S@ t0$( ,0@@PtڠP00``p LpQ  P p@00@@0p p`l``p0  ~P@ pP`SR+>@0p`@  0X W@0`P`(p`$``P@0 ( @ 0PP 0@TPP0@ R 0 P U Qp`@0P``P > 00q``> tp>pGtphP@P 4@PW00gt@Ptڠ 0`@ pPQPppt@l p  70@Pp @ `P0pR0 Q 0P`P`0 P`@0p@@  0X W@0P`@ (@ $0` @ (p` Q Q TSp`@0P``` ( Z  j? $0$`P@0$p(4p0%p@  0 `p``04` Q Q V0U@ Q 4`0p`TSQRd0V` U0 P(P@0`$` (p$`ppW 0S @R Q,P 0@,`TSQRd0Q` R0 P,0PQR``0WdX00 p @00@S ,0P`@hPP%xPp`P|x 000t`P0|ЍG-Mp`p<880P!<Pᣇ  O00 pXp0X @0O0pP0p`p}pP@0S0?X  vp` B?`p `p@0`p`PWp``` 00J0 D`P> P` h0`d 咒Ss@0P` TS0pp@0`P V U@0p@P`@00S@YV0AU?@08`P@0  ``p?  00@P0 P` 0`p000X@TTPUp`0S? 0 P@ t`P0 0 0```p\0/R Q~\``P00@s 0@@00@`p d\\Pph`0`,~@@ pP`S D^ =@0pPP0@XW@0Pp@ <딀   6P@? p``p0 | 0x@PYX@0\ `0咒Ss@0P` TS>pp@0`P V U@0p0`|00`t U@t`<T0`PPU`XW p*"& @h0\ \ 0L 010 1<0   03Q00 0003Q00 0003Q00l@pX 8#w ЍG-`ᦪ 8 #8S A   00H@@:#VpPT  h  0  003S,'0 h0 h0S5SS 0 0  003S  0  003S 0  0  003S  0  003S H0 0 0 @UPPpWZ 0 8#lp?G-* 8(M #8S A  00 00I@ @:#f.PS 0, ph0P0UA:UU <0  0 003\00 0 003\00 000 3R"70lp0  0 003\00 0 003\000003QH0 070 @V``Z R 0 8#?lЍ6S< S6S < SR< SR< S`@-@ @6#:S#8HX"@w@!QX0X!`0B 4$0`0(0  `:#ŀ@lpA-p Md~(10S S ES( BH$HP0 h0:#6!SB|0@0H$H P0h0 : #6SAt0@1X%X @L`0Dh0 : #6SL }P01pl Ѝp@-@ 0 Ph00`S S S 0J$F{ 01J$F!J01$F0 `pplG-`("( )8HT*H@*TH2@0@bP) 8#8XU*@P*U@2P0Ȁb,'8(8"!8 S(00S^L  0,  0R 0`00a\0C00Ѝ 0 QaB! P`BP:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!\`B-@-p(%R0@- b\P0l1C1R02L0G- ᴣ Y 4M( @h0iTPPC(R`a0bVppC `pR,0 $0 VV *VV#3 32 00 0s0Z c 0c  <3  OVf`V*VV#326 00 0s0  f 50 0cl1S023, &x(@9,8HT*@*T@0@bP'8#8XU*P*UP0PbP(&xu@ ,8HT*@*T@0@bcP 8#8XU*P*UP0Pb P$ R  0 3< 00W 0 0 W*WW#3d07 00 0s00 S\: \ $0St  kl<(0 0c063|l 1R<2   '8#8 0@  ,8HT*H@*TH2@0@b P  8#8XU*@P*U@2P0Pb8P#&Ƞ ( Ȍ"!Ȭ\ 00S^0^$Q  0Q  321<"  0 $ (0S 0c d0S B 0 4Ѝ0QaB+ -P`BP":QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!" l!\`B-AC- x"h X `"&$ 0@-@`0aTPPC0Q31P:PG-pᴣ`S $M  WHW*WW#3t32 00 s p  0`13 ("( ' @ ` !8HT*`F@*T`F2@0@bP 8 #8XU*@P*U@2Ȁ00WpW*WW#3827 00 s g7 `p 9R12 '("( @Z `)8HT*`F@*T`F2@0@bPE 8#8XU*@P*U@2P0hb`8#8 '0@ *` !8HT*`F@*T`F2@0@byP 8 #8XU*@P*U@2Ȁn V00hV*VV#3006 00 s YQ1P,@( `72`p 9R12 &(8#8 06@  )8HT*H@*TH2@0@b !P  8#8XU*@P*U@2P0Ȁb,'8(8"!8 S 00S^L  00$ЍG-pᜣ`S 4M  WMW*WW#3\32 00 0s0 s 0c  13  '300@ a` ,8HT*`F@*T`F2@0@bPK2 0XU*@P*U@2P0ȀPb P  W2pW*WW#3 27 00 0s0 g00: lq9\2<! '10 0k@ `)8HT*`F@*T`F2@0@bVP 010 XU*@P*U@2P0hb` '000;@ ` ,8HT*`F@*T`F2@0@b%Pp0 0XU*@P*U@2P0ȀPb PT R 0 31( $0D( V0T 0R $V*VV#3d06 00 0s0 0YS:S T0  Sm  $eD(0 0c073l|9Q21, &80p100@W )8HT*H@*TH2@0@bPB 00 XU*@P*U@2P0Ȁb,'(8 "" P 00S^L ^T00Q 0 S21 29 $0( T ,00004ЍQ 0 P:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!-G-`(pS (M VV*VV#322 00 0s0R c 0c 13IV`V*VV#3`26 00 0s0f1  0 bc8R<2 &x)@(8HT*@*T@0@bPs8#8XU*P*UP0b)&x@^,8HT*@*T@0@bPL8#8XU*P*UP0PbP R 0 3<0 W   W*WW#3`07 00 0s00XS:SQn    f$H(0 0c063|l8Q21, '8Ƞ,Ƞ0S@ (8HT*I@*TI2@0@b>P 8#8XU*@P*U@2P0b 8#&Ƞ ( Ȍ"!Ȭ\00S^ ^0S  R 1< 180  0(ЍQ& 0P1QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!"l!-r<< ?? ? ????? @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ !@0 #@N@P@@@@@@@@@@@@@@@@@@@@@@@@@@@A0A 8A`A A A CD@ qD@ D 0E07E0>E0EE LE `] ] ]0n0n0 oo`ttt`duquu y{|4|n|||||}D} G}^}x}}㉃㵃ヅ 㝅 㽈 20㝉㹉0E0㴋Z0s0㕍0㮍0%0`i ㌎ 㥎㱎 0 @0Re@0㯏0㴑Ñϑ0M\@h 㕥㳥0۲0|100}0@ 0f0my00  g``  R0     0000000  0`0(Q*+@OP0OPP P j%㽭ȭDJP0Zݳϼ@  #U%%%&&S&p&'0P0b11[ [__6yYy@}0 ydp}@_nP@ i _ |0=! ! !0#P$$$ %W%b%l%v%}%`&& '#'-' &(0 O(- 1-@g-0o- -@`- -31X11V2c2 3 73m333@44@444445P 898@b8@8@80@P90 ~90@990@9 : :0:; n< s<H=M=_=>?C C@pF@}FF@FF JMJqJJJ J|LL0YpY YY Y 0ZP0Z 0%Z02Z 0Elsz00 0 0 0 4; AMT\ @P@ 020 RZ initTERM=linuxHOME=/ramida/c0d15pida/c0d14pida/c0d13pida/c0d12pida/c0d11pida/c0d10pida/c0d9pida/c0d8pida/c0d7pida/c0d6pida/c0d5pida/c0d4pida/c0d3pida/c0d2pida/c0d1pida/c0d0phdlhdkhdjhdihdhhdghdfhdehddhdchdbhdanfs/dev/ether=reboot=kbd-resetconsole=panic=video=noinitrdramdisk_size=ramdisk=prompt_ramdisk=load_ramdisk=ramdisk_start=profile=reserve=swap=pci=ip=nfsaddrs=nfsroot=root=idehdCalibrating delay loop... %lu.%02lu BogoMIPS rorwdebuginit=<2>initrd overwritten (0x%08lx < 0x%08lx) - disabling it. POSIX conformance testing by UNIFIX linuxrc/dev/consoleError: unable to open an initial console -- initrd bypassed. /linuxrc/initrd<3>Change root to /initrd: error %d Warning: unable to open an initial console. /sbin/init/etc/init/bin/init/bin/shNo init found. Try passing init= option to kernel.Linux version 2.2.16-20000713 (root@jay) (gcc version 2.95.2 20000516 (release) [Rebel.com]) #2 Thu Aug 17 16:31:21 EDT 2000 set_dma_pageset_dma_page%s: dma %d not supported %2d: %s <3>Trying to allocate DMA%d <3>Trying to free DMA%d <3>Freeing active DMA%d <3>Trying to free free DMA%d <3>set_dma_addr: altering DMA%d address while DMA active <3>set_dma_count: altering DMA%d count while DMA active <3>set_dma_mode: altering DMA%d mode while DMA active <3>Trying to enable free DMA%d <3>Trying to disable free DMA%d <7>PCI: [%04X:%04X] status = %X <7>PCI: parity error target abort master abort data parity error discard timer expired system error pc=[<%08lX>] PCI errorW83977AF configurationIdentifier: %02X Card no = %d Slider base: %02X%02X (201) WaveArtist base: %02X%02X (%X), irq: %d (%d), dma: %d (%d) SoundBlaster base: irq: %d (%d), 8-bit DMA: %d (%d) AdLib base: %02X%02X (%X) SoundBlaster: DSP reset failed SoundBlaster DSP reset: %02X (AA) SoundBlaster: DSP not ready SoundBlaster DSP id: %04X SoundBlaster: could not turn speaker off <6>Netwinder kbd beep disabled - no audio hardware... cascadepic1pic2%3d: %10u %s, %s<6>THUNK! Invalid interrupt %d detected <3>Trying to free IRQ%d <3>Trying to free free IRQ%d Reboot failed -- System halted pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%ckerneluser IRQs %s FIQs %s Mode %s Segment %s onoffControl: %04X Table: %08X DAC: %08X f%d: 0x%08lx 0x%08lx 0x%08lx (float) (double) (extended) fpsr: 0x%08lx fpcr: 0x%08lx ptrace: bad page directory %08lx ptrace: bad page middle %08lx ptrace_cancel_bpt: bogus nsaved: %d! CPU configuration botched (ID %08x), unable to continue. Processor: %s %s revision %d %s%cmem=initrd extends beyond end of memory (0x%08lx > 0x%08lx) - disabling initrd <4>Warning: bad NeTTrom parameters detected, using defaults EBSA110Acorn-RiscPCunknownFTV/PCIEBSA285Rebel-NetWinderChalice-CATSunknown-TBOXco-EBSA285CL-PS7110Acorn-ArchimedesAcorn-A5000EtoileLaCie_NASCL-PS7500SharkSA1100-baseds<4>Warning: bad configuration page, trying to continue Processor : %s %s rev %d (%s) BogoMIPS : %lu.%02lu Hardware : %s Revision : %04x Serial : %08x%08x xchg<5>%s (%d): unsupported llseek call standard <5>%s (%d): unsupported mount call standard <5>%s (%d): obsolete uname call <5>%s (%d): obsolete olduname call timer<4>RTC: *** warning: CMOS battery bad SYS_32UK14_32UK13_32UK12_32UND_32UK10_32UK9_32UK8_32ABT_32UK6_32UK5_32UK4_32SVC_32IRQ_32FIQ_32USER_32UK15_26UK14_26UK13_26UK12_26UK11_26UK10_26UK9_26UK8_26UK7_26UK6_26UK5_26UK4_26SVC_26IRQ_26FIQ_26USER_26interruptaddress exceptiondata abortprefetch abort%08lx: %08lx Code: (%08lx) pc not in code space Internal error: %s: %x CPU: %d Process %s (pid: %d, stackpage=%08lx) Stack: invalid kernel stack pointer %08lxkernel stack pointer underflowBacktrace: no frame pointerinvalid frame pointer %08lxframe pointer underflow<3>bad user access alignment: ptr = %p, pc = %p <6>%s (%d): undefined instruction: pc=%08lx Oops - undefined instruction<6>%s (%d): address exception: pc=%08lx Oops - address exceptionHmm. Unexpected FIQ received, but trying to continue You may have a hardware problem... <2>Bad mode in %s handler detected: mode %s <2>Vectors: <2>Stubs: Oopsbranch through zero[%d] %s: arm syscall %d <3>[%d] %s: old system call. Mal-aligned pointer in %s: %p (PC=%p) Invalid pointer size in %s (pc=%p) size %d set_dma_pageset_dma_pagecascadeportshiftportbasemembaseisabus<7>PCI: Intel 21285 Footbridge revision %02lx /'7set_dma_pageMem-info: Free swap: %6dkB %d pages of RAM %d free pages %d reserved pages %d pages shared Memory: %luk/%luM available (%dk code, %dk reserved, %dk data, %dk init) %dk %sFreeing unused kernel memory:initnetwinderebsa285/cats Bad pmd in pte_alloc: %08lx Bad pmd in pte_alloc_kernel: %08lx <1>*pgd = %08lx(bad) , *pmd = %08lx, *pte = %08lx, *ppte = %08lx NULL pointer dereferencepaging request<1>Unable to handle kernel %s at virtual address %08lx <1>memmap = %08lX, pgd = %p Oops%s: memory violation at pc=0x%08lx, lr=0x%08lx (bad address=0x%08lx, code %d) VM: killing process %s User: %li System: %li Skipped: %li Half: %li Word: %li Multi: %li sys/debug/alignment<3>Unaligned trap: not handling swp instruction Alignment trap: not handling instruction %08X at %08lX<3>Not handling ldrt/strt correctly Alignment trap: not handling LDM with s-bit <7>Weirdness detected (%08X) <7>Please read http://www.arm.linux.org.uk/state.html for more informationvector exceptionsection permission fault%s: permission fault on section, address=0x%08lx, code %d Alignment exceptionTerminal exceptionExternal abort on translationDomain faultExternal abort on linefetchExternal abort on non-linefetchTrying to free non-small page from %p Trying to free free small page from %p remap_area_pte: page already exists signal_queue<2>SIG: sigpending lied <7>eh? notify_parent with state %ld? _^]\[bug: kernel timer added twice at %p. <3>schedule_timeout: wrong timeout value %lx from %p Scheduling in interrupt <5>Clock: inserting leap second 23:59:60 UTC <5>Clock: deleting leap second 23:59:59 UTC WTZDSR%-8s %3d current %08lX %5lu %5d %6d %5d %7d %5d %08lx sig: %d %s %s : %d X free sibling task PC stack pid father child younger older wchan uid_cacheCannot create uid taskcount SLAB cache <3>copy_files: pid %d, open files %d exceeds max %d! files_cacheCannot create files cacheLinux<3>No execution domain for personality 0x%02lx <0>Kernel panic: %s <0>In swapper task - not syncing <0>In interrupt handler - not syncing <0>Rebooting in %d seconds..ttyS<0>Restarting system. <0>System halted. <0>Power down. <0>Restarting system with command '%s'. <3>init_module: Invalid module header size. <3>A new version of the modutils is likely needed. <3>init_module: Size of initialized module exceeds size of created module. <3>init_module: mod->name out of bounds. <3>init_module: mod->syms out of bounds. <3>init_module: mod->deps out of bounds. <3>init_module: mod->init out of bounds. <3>init_module: mod->cleanup out of bounds. <3>init_module: mod->ex_table_* invalid. <3>init_module: mod->flags invalid. <3>init_module: mod->can_unload out of bounds. <3>init_module: changed module name to `%s' from `%s' <3>init_module: self-referential dependency in mod->deps. <3>init_module: found dependency that is (no longer?) a module. %8lu%4ld (deleted) (autoclean) (unused) (initializing) (uninitialized) [ ] %0*lx %s [%s] %0*lx %s task releasing itself Aiee, killing interrupt handler Attempted to kill the idle task!%08lx-%08lx : %s 4K limit reached! warning: ioport table is full reservedunknowndevdebugfsprocnetvmkernelsysrqshmallshmmaxrtsig-maxrtsig-nracctmodprobeprintkctrl-alt-delreal-root-devcap-boundpanicdomainnamehostnameversionosreleaseostypepage-clusterpagetable_cachekswapdpagecachebuffermemovercommit_memorybdflushfreepagesdentry-statedquot-maxdquot-nrsuper-maxsuper-nrfile-maxfile-nrinode-maxinode-stateinode-nr<4>SYSCTL: Can't register %s <1>Help - malformed sysctl tree on free %d<6>Process accounting paused <6>Process accounting resumed PATH=/sbin:/usr/sbin:/bin:/usr/binTERM=linuxHOME=/-s-k<3>kmod: failed to exec %s -s -k %s, errno = %d <3>request_module[%s]: Root fs not mounted <3>kmod: runaway modprobe loop assumed and stopped <3>request_module[%s]: fork failed, errno %d <3>request_module[%s]: waitpid(%d,...) failed, errno %d free_one_pmd: bad directory entry %08lx free_one_pgd: bad directory entry %08lx <3>free_page_tables: Trying to free kernel pgd copy_pmd_range: bad pgd (%08lx) copy_pte_range: bad pmd (%08lx) forget_pte: old mapping existed! zap_pte_range: bad pmd (%08lx) zap_pmd_range: bad pgd (%08lx) put_dirty_page: trying to put page %08lx at %08lx mem_map disagrees with %08lx at %08lx put_dirty_page: pte %08lx already exists do_wp_page: bogus page at address %08lx (%08lx) bad page table directory entry %p:[%lx] find_vma_prev: tree inconsistent with list exit_mmap: map count is %d insert_vm_struct: tree inconsistent with list vm_area_structvma_init: Cannot alloc vm_area_struct cache.mm_structvma_init: Cannot alloc mm_struct cache.filemap_sync_pte_range: bad pmd (%08lx) filemap_sync_pmd_range: bad pgd (%08lx) <3>get_cached_page: page count=%d <3>get_cached_page: page already locked! put_cached_page: page not locked! put_cached_page: page count=%d kpiodpio_requestCould not create pio_request slab cachePage cache hash table entries: %d (order %ld, %ldk) Failed to allocate page hash table change_pte_range: bad pmd (%08lx) change_pmd_range: bad pgd (%08lx) move_one_page: bad source pgd (%08lx) move_one_page: bad source pmd (%08lx) free_area_pte: bad pmd (%08lx) Whee.. Swapped out page in kernel page table free_area_pmd: bad pgd (%08lx) alloc_area_pte: page already exists Trying to vfree() bad address (%p) Trying to vfree() nonexistent vm area (%p) size-131072size-65536size-32768size-16384size-8192size-4096size-2048size-1024size-512size-256size-128size-64size-32kmem_cachekmem_cache_init(): Offsets are wrong - I've been messed with!slab_cachekmem_cache_sizes_init: Error creating caches<3>kmem_create: %sNULL ptr %sCalled during int - %s %sSize too small %d - %s %sSize too large %d - %s %sDecon but no con - %s %sOffset weird %d - %s %sIllgl flg %lX - %s %sForcing size word alignment - %s %sDup name - %s <3>kmem_shrink: NULL ptr <3>kmem_shrink: Called during int - %s <3>kmem_shrink: Invalid cache addr %p <4>kmem_grow: Illegal flgs %X (correcting) - %s <3>kmem_grow: Called nonatomically from int - %s <3>kmem_alloc: %s (name=%s) unknown<3>kmem_free: %s (objp=%p, name=%s) Bad slab magic (corrupt)NULL ptrfree with no active objsEither bad obj addr or double freefree from inactive slabBad obj addr<3>kmalloc: Size (%lu) too large <3>kfree: Bad obj %p <3>kfree_s: Bad obj %p kmem_cache_reap() called within int! <3>kmem_reap: Corrupted cache struct for %s slabinfo - version: 1.0 %-17s %6lu %6lu set_dma_pageswap_out_pmd: bad pmd (%08lx) swap_out_pgd: bad pgd (%08lx) VM: do_try_to_free_pages failed for %s... $Revision: 1.5 $Starting kswapd v%.*s kswapdInternal error: bad swap-device rw_swap_page: weirdness <3>rw_swap_page: Trying to %s unallocated swap (%08lx) readwrite<3>rw_swap_page: Trying to swap to unused swap-device <3>VM: swap page is unlocked swap entry mismatchrw_swap_page: bad swap file <3>rw_swap_page: no swap file or device swap_after_unlock_page: lock already cleared <3>rw_swap_page: page unused while waiting! swap_after_unlock_page: bad swap-device swap_after_unlock_page: weirdness Tried to swap a non-swapper pageVM: swap page is not in swap cache VM: read_swap_page: page already in swap cache! VM: read_swap_page: page already in page cache! VM: rw_swap_page_nolock: page not locked! VM: rw_swap_page_nolock: page in swap cache! set_dma_pageFreeing swap cache pageFree pages: %6dkB ( Free: %d (%d %d %d) %sDMA: Non%lu*%lukB = %lukB) Swap cache: add %ld, delete %ld, find %ld/%ld <3>swap_cache: replacing non-empty entry %08lx on page %08lx <3>swap_cache: replacing page-cached entry on page %08lx <4>swap_duplicate: entry %08lx map count=%d <3>swap_duplicate: entry %08lx, nonexistent swap file <3>swap_duplicate: entry %08lx, offset exceeds max <3>swap_duplicate at %8p: entry %08lx, unused page <3>swap_count: null entry! <3>swap_count: entry %08lx, nonexistent swap file! <3>swap_count: entry %08lx, offset exceeds max! <3>swap_count at %8p: entry %08lx, unused page! VM: Removing swap cache page with zero inode hash on page %08lx VM: Removing swap cache page with wrong inode hash on page %08lx <3>VM: Found a non-swapper swap page! swap_free: Trying to free nonexistent swap-page swap_free: Trying to free swap from unused swap-device swap_free: offset exceeds max swap_free: swap-space map bad (entry %08lx) unuse_pmd: bad pmd (%08lx) unuse_pgd: bad pgd (%08lx) <3>try_to_unuse: entry %08lx count=%d Filename Type Size Used Priority %-31s file partition %d %d %d Unable to start swapping: out of memory :-) SWAP-SPACESWAPSPACE2Unable to find swap-space signature <4>Unable to handle swap header version %d <4>Empty swap-file <6>Adding Swap: %dk swap-space (priority %d) chown_common: NULL inode get_unused_fd: slot %d not NULL! VFS: Close: file count is 0 Character devices: %3d %s Block devices: block-major-%dchar-major-%d<7>VFS: Disk change detected on device %s VFS: busy inodes on changed media. %02x:%02xunknown-block%s(%d,%d)unknown-charfilpVFS: Cannot alloc filp SLAB cache.VFS: filp allocation failed VFS: file-max limit %d reached VFS: LRU block list corruptedLRU list corruptedVFS: Free block list corruptedFree list corruptedFree list emptyB_FREE inserted into queuesVFS: buffer LRU pointers corruptedInvalid blocksize passed to set_blocksize<4>set_blocksize: dev %s buffer_dirty %lu size %lu <4>set_blocksize: b_count %d, dev %s, block %lu, from %p Attempt to refile free buffer VFS: brelse: Trying to free free buffer Whoops: end_buffer_io_async: async io complete on unlocked page Whoops: end_buffer_io_async: b_count != 1 on async io. brw_page: page not locked for I/OVFS: grow_buffers: size = %d DIRTYLOCKEDCLEANBuffer memory: %8ldkB Buffer heads: %6d Buffer blocks: %6d Buffer hashed: %6d %8s: %d buffers, %d used (last=%d), %d locked, %d protected, %d dirty Buffer cache hash table entries: %d (order %d, %ldk) Failed to allocate buffer hash table buffer_headCannot create buffer head SLAB cache Dirty list empty %d kflushdkupdateunknown,nodiratime,noatime,mand,sync,nodev,nosuid,noexec,noac,nocto,posix,intr,soft%s %s %s %srorwnfs,rsize=%d,wsize=%d,acregmin=%d,acregmax=%d,acdirmin=%d,acdirmax=%d,addr=%s 0 0 %s %s nodevVFS: empty superblock %p locked! VFS: on device %s: get_fs_type(%s) failed VFS: put_unnamed_dev: freeing unused device %s VFS: mount - already mounted VFS: Busy inodes after unmount. Self-destruct in 5 seconds. Have a nice day... /dev/root/<5>VFS: Mounted root (NFS filesystem)%s. readonly<3>VFS: Unable to mount root fs via NFS, trying floppy. VFS: Cannot open root device %s VFS: Mounted root (%s filesystem)%s. VFS: add_vfsmnt failed for root fsVFS: Unable to mount root fs on %s<2>New root is busy. Staying in initrd. change_root: old root has d_count=%d <5>Trying to unmount old root ... okay <3>error %d /dev/root.old<2>Trouble: add_vfsmnt failed VFS: Warning: %s using old stat() call. Recompile your binary. binfmt-%04xusr/gnemul/bsd/<3>dupfd: fd %d, max %d kill_fasync: bad magic number in fasync_struct! Attempting to free lock with active wait queueAttempting to free lock with active block list<3>locks_insert_block: remove duplicated lock (pid=%d %ld-%ld type=%d) locks_conflict(): impossible lock type - %d %d:%s %6s %s ACCESSPOSIX MANDATORYADVISORY FLOCK ADVISORY %s READ WRITE%d %s:%ld %ld %ld %08lx %08lx %08lx %08lx %08lx ->unknownEFS: 1.0b - (c) 1999 Al Smith <3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! nfsd<2>Negative d_count (%d) for %s/%s /<<4>VFS: moving negative dcache entry (deleted)dentry_cacheCannot create dentry cacheDentry hash table entries: %d (order %d, %ldk) Failed to allocate dcache hash table write_inode_now: no super block <4>grow_inodes: inode-max limit reached grow_inodes: allocation failed <3>iput: inode %s/%ld still has locks! <3>iput: device %s inode %ld still has aliases! <3>iput: device %s inode %ld count changed, count=%d <3>iput: Aieee, semaphore in use inode %s/%ld, count=%d <3>iput: Aieee, atomic write semaphore in use inode %s/%ld, count=%d <3>iput: inode %s/%ld count wrapped <3>free_fd_arrayarray = 0 (num = %d) <3>free_fdsetarray = 0 (num = %d) ELF/usr/lib/libc.so.1/usr/lib/ld.so.1<4>ELF: Ambiguous type, using ELF %d<3>Unable to load interpreter %.128s ELFcore.COREsizeof(elf_gregset_t) (%ld) != sizeof(struct pt_regs) (%ld) RSDZTDelf_core_dump: file->f_pos (%ld) != offset (%ld) core.<5>Binary != ARM. Please recompile binary. <5>executable not page aligned <5>fd_offset is not blocksize aligned. Loading %s in anonymous memory. <5>N_TXTOFF is not blocksize aligned. Loading library %s in anonymous memory. undefinedgroupuserremove_free_dquot: dquot not on the free list?? <4>VFS: dquota write failed on dev %s VFS: dqput: trying to free free dquot VFS: device %s, dquot of %s %d dqput: dquot already on free list?? <3>VFS: Locked quota to be put on the free list. <3>VFS: Locked dquot on the free list <3>VFS: free dquot count=%d VFS: No free dquots, contact mvw@planets.elm.net %s: write failed, %s file limit reached %s: warning, %s file quota exceeded too long. %s: warning, %s file quota exceeded %s: write failed, %s disk limit reached. %s: write failed, %s disk quota exceeded too long. %s: warning, %s disk quota exceeded <5>VFS: Diskquotas version %s initialized dquot_6.4.0dquotCannot create dquot SLAB cache freeundos undo list error id=%d sem_exit undo list error id=%d shm nono: killseg called on unused seg id=%d shm nono: killseg shp->pages=NULL. id=%d shm_open: unused id=%d PANIC %s/c%dd%d%s/c%dd%dp%dhdsd%c%c%d%s%c%d%s%c %sStrange blocksize for partition table <6>Partition check: <6> %s: unknown partition table unable to read partition table [EZD] [DM6:DDO] [DM6:MBR] [DM6:AUX] [PTBL] %s: RESETTINGING SECTOR SCALE from %d to 1 < > Dev %s: unable to read partition table Dev %s SGI disklabel: csum bad, label corrupted ext2_get_group_descblock_group >= groups_count - block_group = %d, groups_count = %luGroup descriptor not loaded - block_group = %d, group_desc = %lu, desc = %luread_block_bitmapCannot read block bitmap - block_group = %d, block_bitmap = %luload_block_bitmapblock_group != block_bitmap_numberext2_free_blocks: nonexistent deviceext2_free_blocksFreeing blocks not in datazone - block = %lu, count = %luFreeing blocks in system zones - Block = %lu, count = %lubit already cleared for block %luext2_new_block: nonexistent deviceext2_new_blockFree blocks count corrupted for block group %dAllocating block in system zone - block = %ubit already set for block %dblock >= blocks count - block_group = %d, block=%dcannot get block %dext2_check_blocks_bitmapSuperblock in group %d is marked freeDescriptor block #%d in group %d is marked freeBlock bitmap for group %d is marked freeInode bitmap for group %d is marked freeBlock #%d of the inode table in group %d is marked freeWrong free blocks count for group %d, stored = %d, counted = %luWrong free blocks count in super block, stored = %lu, counted = %lurec_len is smaller than minimalrec_len % 4 != 0rec_len is too small for name_lendirectory entry across blocksinode out of boundsbad entry in directory #%lu: %s - offset=%lu, inode=%lu, rec_len=%d, name_len=%dext2_readdirdirectory #%lu contains a hole at offset %luext2_file_write: inode = NULL ext2_file_writemode = %07oread_inode_bitmapCannot read inode bitmap - block_group = %lu, inode_bitmap = %luload_inode_bitmapblock_group >= groups_count - block_group = %d, groups_count = %lublock_group != inode_bitmap_numberext2_free_inode: inode has no device ext2_free_inode: inode has count=%d ext2_free_inode: inode has nlink=%d ext2_free_inode: inode on nonexistent device free_inodereserved inode or nonexistent inodeext2_free_inodebit already cleared for inode %luext2_new_inodebit already set for inode %dFree inodes count corrupted in group %dreserved inode or inode > inodes count - block_group = %d,inode=%dext2_check_inodes_bitmapWrong free inodes count in group %d, stored = %d, counted = %luWrong free inodes count in super block, stored = %lu, counted = %luext2_alloc_blockcannot get block %luext2_bmapblock < 0block > bigext2_getblkext2_read_inodebad inode number: %lugroup >= groups countDescriptor not loadedunable to read inode block - inode=%lu, block=%luNew inode has non-zero prealloc count!ext2_write_inodeIO error syncing ext2 inode [%s:%08lx] ext2_find_entryext2_add_entryext2_delete_entry...empty_dirbad directory (dir #%lu) - no data blockbad directory (dir #%lu) - no `.' or `..'ext2_rmdirempty directory has nlink!=2 (%d)ext2_unlinkDeleting nonexistent file (%lu), %dEXT2-fs panic (device %s): %s: %s <2>EXT2-fs error (device %s): %s: %s Remounting filesystem read-only <4>EXT2-fs warning (device %s): %s: %s ,bsddfchecknonenormalstrictEXT2-fs: Invalid check option: %s debugerrorsEXT2-fs: the errors option requires an argumentcontinueremount-ropanicEXT2-fs: Invalid errors option: %s grpidbsdgroupsminixdfnochecknogrpidsysvgroupsresgidEXT2-fs: the resgid option requires an argumentEXT2-fs: Invalid resgid option: %s resuidEXT2-fs: the resuid option requires an argumentEXT2-fs: Invalid resuid option: %s sbEXT2-fs: the sb option requires an argumentEXT2-fs: Invalid sb option: %s grpquotanoquotaquotausrquotaEXT2-fs: Unrecognized mount option %s EXT2-fs warning: revision level too high, forcing read/only mode EXT2-fs warning: mounting unchecked fs, running e2fsck is recommended EXT2-fs warning: mounting fs with errors, running e2fsck is recommended EXT2-fs warning: maximal mount count reached, running e2fsck is recommended EXT2-fs warning: checktime reached, running e2fsck is recommended [EXT II FS %s, %s, bs=%lu, fs=%lu, gc=%lu, bpg=%lu, ipg=%lu, mo=%04lx] 0.5b95/08/09ext2_check_descriptorsBlock bitmap for group %d not in group (block %lu)!Inode bitmap for group %d not in group (block %lu)!Inode table for group %d not in group (block %lu)!EXT2-fs: unable to read superblock VFS: Can't find an ext2 filesystem on dev %s. EXT2-fs: %s: couldn't mount because of unsupported optional features. EXT2-fs: %s: couldn't mount RDWR because of unsupported optional features. EXT2-fs: blocksize too small for device. EXT2-fs: Couldn't read superblock on 2nd try. EXT2-fs: Magic mismatch, very weird ! EXT2-fs: unsupported inode size: %d VFS: Unsupported blocksize on dev %s. EXT2-fs: fragsize %lu != blocksize %lu (not supported yet) EXT2-fs: #blocks per group too big: %lu EXT2-fs: #fragments per group too big: %lu EXT2-fs: #inodes per group too big: %lu EXT2-fs: not enough memory EXT2-fs: unable to read group descriptors EXT2-fs: group descriptors corrupted ! EXT2-fs: get root inode failed ext2trunc_indirectRead failure, inode=%ld, block=%dtrunc_dindirecttrunc_tindirectprocde_put: entry %s already free! de_put: deferred delete of %s ,uidgidproc_iget: using deleted entry %s, count=%d proc_get_inode: inode fubar proc_read_super: get root inode failed /procsys%dloadavguptimememinfokmsgversioncpuinfoselfkcoremodulesksymsstatdevicespartitionsinterruptsfilesystemsfsdmaioportscmdlinertclocksmountsswapsprofileslabinfonetscsibus...proc_file_unlink: deleting %s/%s statusmemcwdrootexefdenvironcmdlinestatstatmmapsremove_proc_entry: %s/%s busy, count=%d Bad page dir entry %08lx Bad page middle entry %08lx Bad source page dir entry %08lx Bad source page middle entry %08lx socket:[%lu]pipe:[%lu]..%d.%02d %d.%02d %d.%02d %d/%d %d cpu %u %u %u %lu disk %u %u %u %u disk_rio %u %u %u %u disk_wio %u %u %u %u disk_rblk %u %u %u %u disk_wblk %u %u %u %u page %u %u swap %u %u intr %u %u ctxt %u btime %lu processes %lu %lu.%02lu %lu.%02lu total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB %s get_phys_addr: pid %d has NULL pgd! bad page directory entry %08lx bad page middle entry %08lx Name: W (paging)T (stopped)Z (zombie)D (disk sleep)S (sleeping)R (running)State: %s Pid: %d PPid: %d Uid: %d %d %d %d Gid: %d %d %d %d Groups: %d VmSize: %8lu kB VmLck: %8lu kB VmRSS: %8lu kB VmData: %8lu kB VmStk: %8lu kB VmExe: %8lu kB VmLib: %8lu kB SigPnd: SigBlk: SigIgn: SigCgt: CapInh: %016x CapPrm: %016x CapEff: %016x %d (%s) %c %d %d %d %d %d %lu %lu %lu %lu %lu %lu %lu %ld %ld %ld %ld %ld %ld %lu %lu %ld %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %d %d statm_pte_range: bad pmd (%08lx) statm_pmd_range: bad pgd (%08lx) %d %d %d %d %d %d %d %08lx-%08lx %s %08lx %s %luNo low-level scsi modules are currently present %d-%d%dsystem:/dev/ttysystem:consolesystem:vtmastersystemconsoleserial:calloutserialpty:masterpty:slaveptytype:%d.%d%-20s /dev/%-8s %3d %7s %s unknown%-10s %2d ???ttytty/ldisctty/drivertty/ldiscstty/driversunknownNFS: put_inode(%x/%ld) NFS: delete_inode(%x/%ld) NFS: Arghhh, stuck RPC requests! NFS: inode %ld had %d failed requests nfs warning: mount version %s than kernel oldernewernfs_read_super: get root inode failed nfs_read_super: get root fattr failed <4>NFS: couldn't start rpciod! <4>NFS: cannot create RPC client. <4>NFS: cannot create RPC transport. NFS: mount program didn't pass remote address! nfs_read_super: missing data argument nfs_statfs: statfs error = %d nfs_free_dentries: found %s/%s, d_count=%d, hashed=%d NFS: nfs_fhget(%s/%s fileid=%d) .snapshotNFS: nfs_fhget(snapshot ino=%ld) __nfs_fhget: inode %ld busy, i_count=%d, i_nlink=%d __nfs_fhget: inode %ld still busy, i_count=%d __nfs_fhget: killing %s/%s filehandle NFS: __nfs_fhget(%x/%ld ct=%d) __nfs_fhget: iget failed __nfs_fhget: unexpected inode from iget nfs_notify_change: revalidate failed, error=%d nfs_notify_change: sattr=%d, fattr=%d?? NFS: revalidating %s/%s, ino=%ld nfs_revalidate_inode: %s/%s getattr failed, ino=%ld, error=%d NFS: bad fh %08x%08x%08x%08x%08x%08x%08x%08x NFS: lookup failed, error=%d %08x%08x%08x%08x%08x%08x%08x%08x nfs_revalidate_inode: %s/%s refresh failed, ino=%ld, error=%d NFS: %s/%s revalidation complete NFS: refresh_inode(%x/%ld ct=%d) nfs_refresh_inode: inode or fattr is NULL nfs_refresh_inode: mismatch, ino=%ld, fattr=%d nfs_refresh_inode: inode %ld mode changed, %07o to %07o nfsunknownnfs: flush(%x/%ld) nfs: read(%s/%s, %lu@%lu) nfs: mmap(%s/%s) nfs: fsync(%x/%ld) nfs: write(%s/%s(%ld), %lu@%lu) <6>NFS: attempt to write to active swap file! NFS: nfs_lock(f=%4x/%ld, t=%x, fl=%x, r=%ld:%ld) unknownNFS: nfs_readpage_sync(%p) NFS: nfs_proc_read(%s, (%s/%s), %ld, %d, %p) NFS: %4d received callback for page %lx, result %d NFS: %d successful reads, %d failures NFS: nfs_readpage_async(%p) NFS: executing async READ request. NFS: deferring async READ request. NFS: failed to enqueue async READ request. NFS: nfs_readpage (%p %ld@%ld) Aiee.. nfs swap-in of page failed! unknownwrite_chainNFS: nfs_writepage_sync(%s/%s %d@%ld) NFS: short write, wsize=%u, result=%d nfs_writepage_sync: prior time?? nfs_writepage_sync: inode %ld, got %u? NFS: append_write_request(%p, %p) NFS: remove_write_request(%p, %p) NFS: find_write_request(%x/%ld, %p) nfs: trying to update write request %p NFS: create_write_request(%s/%s, %ld+%d) NFS: %4d schedule_write_request (sync) NFS: %4d schedule_write_request (async) NFS: nfs_updatepage(%s/%s %d@%ld, sync=%d) NFS: %4d nfs_wback_begin (%s/%s, status=%d flags=%x) NFS: %4d nfs_wback_result (%s/%s, status=%d, flags=%x) nfs_wback_result: inode %ld, got %u? unknownNFS: nfs_readdir(%s/%s) NFS: waiting on dircache entry NFS: found dircache entry %d NFS: dircache contention NFS: using free dircache entry %d NFS: nfs_readdir complete NFS: invalidate dircache for %x/%ld NFS: cache locked for %s/%ld NFS: cache locked at umount %s (lost a page!)NFS: freeing dircache nfs_lookup_validate: %s/%s has dud inode NFS: dentry_delete(%s/%s, %x) NFS: can't silly-delete %s/%s, error=%d (unhashed)show_dentry: %s/%s, d_count=%d%s NFS: lookup(%s/%s) NFS: create(%x/%ld, %s NFS: mknod(%x/%ld, %s NFS: mkdir(%x/%ld, %s NFS: rmdir(%x/%ld, %s NFS: silly-rename(%s/%s, ct=%d) NFS: silly-renaming %s/%s, negative dentry?? .nfs%*.*lx%*.*xtrying to rename %s to %s NFS: safe_remove(%s/%s, %ld) nfs_safe_remove: %s/%s already negative?? nfs_safe_remove: %s/%s busy, d_count=%d NFS: unlink(%x/%ld, %s) NFS: symlink(%x/%ld, %s, %s) nfs_proc_symlink: %s/%s not negative! nfs_proc_symlink: %s/%s already exists?? NFS: link(%s/%s -> %s/%s) NFS: rename(%s/%s -> %s/%s, ct=%d) nfs_rename: target %s/%s busy, d_count=%d nfs_rename: new dentry %s/%s busy, d_count=%d unknownnfs: readlink(%s/%s) nfs: follow_link(%s/%s) unknownNFS call getattr NFS reply getattr NFS call setattr NFS reply setattr NFS call lookup %s NFS reply lookup: %d NFS call readlink NFS reply readlink: %d NFS call read %d @ %ld NFS reply read: %d NFS call write %d @ %ld NFS call create %s NFS reply create: %d NFS call remove %s NFS reply remove: %d NFS call rename %s -> %s NFS reply rename: %d NFS call link %s NFS reply link: %d NFS call symlink %s -> %s NFS reply symlink: %d NFS call mkdir %s NFS reply mkdir: %d NFS call rmdir %s NFS reply rmdir: %d NFS call readdir %d NFS reply readdir: %d NFS call statfs NFS reply statfs: %d unknownRPC: readres OK status %lx NFS: Odd RPC header size in read reply: %d NFS: server cheating in read reply: count %d > recvd %d RPC: readres OK count %d NFS: Odd RPC header size in readdirres reply <4>NFS: server %s, readdir reply truncated <4>NFS: nr=%d, slots=%d, len=%d NFS: giant filename in readdir (len %x)! NFS: incorrect buffer size in %s! nfs_xdr_readdirresRPC: attrstat status %lx RPC: attrstat OK type %d mode %o dev %x ino %x RPC: diropres status %lx RPC: diropres OK type %x mode %o dev %x ino %x nfs_stat_to_errno: bad nfs status return value: %d nfs_statfsnfs_readdirnfs_rmdirnfs_mkdirnfs_symlinknfs_linknfs_renamenfs_removenfs_createnfs_writenfs_writecachenfs_readnfs_readlinknfs_lookupnfs_rootnfs_setattrnfs_getattrnfs_nullnfsunknownacdirmaxacdirminacregmaxacregminretranstimeowsizersizeportnoacacnoctoctonoposixposixnointrintrhardsoft,default/tftpboot/%s<3>Root-NFS: Pathname for remote directory too long. <3>Root-NFS: No NFS server available, giving up. <5>Looking up port of RPC %d/%d on %s <3>Root-NFS: Unable to get nfsd port number from server, using default Root-NFS: Portmapper on server returned %d as nfsd port <3>Root-NFS: Unable to get mountd port number from server, using default Root-NFS: mountd port is %d <3>Root-NFS: Server returned error %d while mounting %s unknownNFS: nfs_mount(%08x:%s) mnt_mountmnt_nullmountunknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! unknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: CANCEL call failed (errno %d) <4>lockd: Uh-oh! Interfering reclaims for host %sunknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! %d@%slockd: clnt proc returns %d nlmclnt_alloc_call: failed, waiting for memory lockd: call procedure %s on %s lockd: rpc_call returned error %d lockd: server in grace period <4>lockd: spurious grace period reject?! lockd: server returns status %d lockd: call procedure %s on %s (async) <5>lockd: failed to monitor %s <4>lockd: failed to reclaim lock for pid %d (errno %d, status %d) lockd: unexpected unlock status: %d lockd: unlock failed (err = %d) lockd: CANCEL call error %d, retrying. lockd: cancel status %d (task %d) lockd: CANCEL failed (server has no locks) <5>lockd: weird return %d for CANCEL call <5>lockd: unexpected status NLM_BLOCKED <5>lockd: unexpected server status %d unknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: no clnt or addr in lookup_host! lockd: nlm_lookup_host(%08x, p=%d, v=%d) lockd: creating host entry %d.%d.%d.%dlockd: nlm_bind_host(%08x) lockd: next rebind in %ld jiffies lockd: couldn't create RPC handle for %s lockd: rebind host %s lockd: release host %s lockd: shutting down host module lockd: nuking all hosts... <4>lockd: couldn't shutdown host module! lockd: %d hosts left: %s (cnt %d use %d exp %ld) lockd: host garbage collection lockd: delete host %s <4>lockd: active RPC handle unknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockdNFS locking service started (ver 0.4). <4>lockd: terminating on error %d lockd: request from %08x <7>lockd: new process, skipping host shutdown <4>lockd_up: no pid, %d users?? <4>lockd_up: create service failed <4>lockd_up: makesock failed, error=%d <4>lockd_up: create thread failed, error=%d <4>lockd_down: no users! pid=%d <4>lockd_down: no lockd running. <4>lockd_down: lockd failed to exit, clearing pid unknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlmsvc_insert_block(%p, %ld) lockd: nlmsvc_lookup_block f=%p pd=%d %ld-%ld ty=%d check f=%p pd=%d %ld-%ld ty=%d lockd: created block %p... lockd: deleting block %p... lockd: deleting granted lock lockd: unblocking blocked lock lockd: nlmsvc_lock(%04x/%ld, ty=%d, pi=%d, %ld-%ld, bl=%d) lockd: posix_lock_file returned %d lockd: blocking on this lock (allocating). lockd: blocking on this lock. lockd: nlmsvc_testlock(%04x/%ld, ty=%d, %ld-%ld) lockd: conflicting lock(ty=%d, %ld-%ld) somehostlockd: nlmsvc_unlock(%04x/%ld, pi=%d, %ld-%ld) lockd: nlmsvc_cancel(%04x/%ld, pi=%d, %ld-%ld) lockd: VFS unblock notification for block %p <4>lockd: notification for unknown block! lockd: grant blocked lock %p lockd: lock still blocked <4>lockd: unexpected error %d in %s! nlmsvc_grant_blockedlockd: GRANTing blocked lock. lockd: GRANT_MSG RPC callback lockd: no block for cookie %x nlmsvc_retry_blocked(%p, when=%ld) nlmsvc_retry_blocked(%p, when=%ld, done=%d) unknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! unknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: unauthenticated request from (%08x:%d) lockd: NULL called lockd: TEST called lockd: TEST status %d lockd: LOCK called lockd: LOCK status %d lockd: CANCEL called lockd: CANCEL status %d lockd: UNLOCK called lockd: UNLOCK status %d lockd: GRANTED called lockd: GRANTED status %d lockd: TEST_MSG called lockd: LOCK_MSG called lockd: CANCEL_MSG called lockd: UNLOCK_MSG called lockd: GRANTED_MSG called lockd: SHARE called lockd: SHARE status %d lockd: UNSHARE called lockd: UNSHARE status %d lockd: NM_LOCK called lockd: SM_NOTIFY called <4>lockd: rejected NSM callback from %08x:%d lockd: %4d callback failed (errno = %d) unknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlm_file_lookup(%s/%u) lockd: creating file for %s/%u lockd: open failed (nfserr %d) lockd: found file %p (count %d) lockd: closing file %s/%ld <4>lockd: attempt to release unknown file! lockd: unlock failure in %s:%d svcsubs.clockd: nlm_release_file(%p, ct = %d) lockd: nlmsvc_mark_resources lockd: nlmsvc_free_host_resources <4>lockd: couldn't remove all locks held by %slockd: invalidating client for %s unknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nsm_%s(%s) <7>nsm_mon_unmon: rpc failed, status=%d <5>lockd: cannot %s %s monitorunmonitorlocalhostnsm: xdr_encode_mon(%08x, %d, %d, %d) %d.%d.%d.%dnsm: xdr_decode_stat_res status %d state %d sm_notifysm_simu_crashsm_unmon_allsm_unmonsm_monsm_statsm_nullstatdunknown<3>fh_copy: copying %s/%s, already verified! <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: bad cookie size %d (only cookies under 8 bytes are supported.) <5>lockd: bad fhandle size %x (should be %d) nlm_undefnlm_granted_resnlm_unlock_resnlm_canc_resnlm_lock_resnlm_test_resnlm_granted_msgnlm_unlock_msgnlm_canc_msgnlm_lock_msgnlm_test_msgnlm_grantednlm_unlocknlm_cancnlm_locknlm_testnlm_nulllockdUnable to load NLS charset %s: name too long nls_%sUnable to load NLS charset %s defaultcp437...%ddevpts_put_super: badness: entry %d count %d ,uidgidmodedevpts: called with bogus options devpts: get root dentry failed devpts<3>socki_lookup: socket file changed! <3>sock_release: fasync list not empty! <7>sock_close: NULL inode net-pf-%d<4>socket: no more sockets <2>protocol %d >= NPROTO(%d) <6>Linux NET4.0 for Linux 2.2 <6>Based upon Swansea University Computer Society NET3.039 sockets: used %d INETSNAP802.2UNIXNETLINK<7>sk_free: optmem leakage (%d bytes) detected. sockskput:over: %p:%d put:%d dev:%sskput:under: %p:%d put:%d dev:%sNetworking buffers in use : %u Total network buffer allocations : %u Total failed network buffer allocs : %u IP fragment buffer size : %u <3>alloc_skb called nonatomically from interrupt %p <4>Warning: kfree_skb passed an skb still on a list (from %p). skbuff_head_cachecannot create skbuff cacheoptmem_maxmessage_burstmessage_costnetdev_max_backlogrmem_defaultwmem_defaultrmem_maxwmem_max100baseFX100baseTX100baseTAUI10baseTBNCunknown<4>dev_remove_pack: %p not found. <7>%s: default_rebuild_header called -- BUG! NULL!!!dev_close: bug %s still running <7>protocol %04x is buggy, dev %s <7>BUG: packet without dst looped back 1 <7>Virtual device %s asks to queue packet! <2>%s: wrong mac.raw ptr, proto=%04x %6s:%8lu %7lu %4lu %4lu %4lu %5lu %10lu %9lu %8lu %7lu %4lu %4lu %4lu %5lu %7lu %10lu %6s: No statistics available. Inter-| Receive | Transmit face |bytes packets errs drop fifo frame compressed multicast|bytes packets errs drop fifo colls carrier compressed %08x %08x %08x %08x %08x <6>device %s %s promiscuous mode enteredleft<6>early initialization of device %s is deferred devnet/dev_statdev_mc_discard: multicast leakage! dmi_users=%d %-4d %-15s %-5d %-5d %02x net/dev_mcastneigh_ifdown: impossible event 1763 neigh_destroy: neighbour is use tbl=%p, ref=%d: called from %p neigh: timer & !nud_in_timer neigh_resolve_output: dst=%p neigh=%p neigh_release_parms: not found <2>neighbour leakage netneighdefaultgc_thresh3gc_thresh2gc_thresh1gc_intervallocktimeproxy_delayanycast_delayproxy_qlenunres_qlengc_stale_timedelay_first_probe_timebase_reachable_timeretrans_timeapp_solicitucast_solicitmcast_solicit $$$  Initializing RT netlink socket rtnetlink_init: cannot initialize rtnetlink <4>NET: %d messages suppressed. <7>%s: unable to resolve type %X addresses. EtherII<7>%s deferred output. It is buggy. <6>%s: activation failed Assertion (dev->qdisc_list == NULL) failed at sch_generic.c(%d):dev_shutdown sch_%s%08x %08x net/pschedcls_%sAssertion (0) failed at police.c(%d):tcf_police_destroy 802.2SNAP - unable to register with 802.2 SNAP802.3ESPGREICMPTCPUDPIP_%dBUG!LISTENLAST_ACKCLOSE_WAITCLOSETIME_WAITFIN_WAITSYN_RECVSYN_SENTESTABLISHEDNONEERR!<3>IP_MASQ:ip_masq_hash(): request for already hashed, called from %p <3>IP_MASQ:ip_masq_unhash(): request for unhash flagged, called from %p <3>IP_MASQ:ip_masq_new(proto=%s): no free ports. <3>IP_MASQ:ip_masq_new(proto=%s): no memory available. <3>IP_MASQ:Already used connection: %s, %d.%d.%d.%d:%d => %d.%d.%d.%d:%d, called from %p <3>IP_MASQ:ip_masq_new(proto=%s): could not get free masq entry (free=%d). <6>IP_MASQ:ip_fw_masquerade(): change masq.addr from %d.%d.%d.%d to %d.%d.%d.%d <6>IP_MASQ:ip_fw_masq_icmp(): change masq.addr %d.%d.%d.%d to %d.%d.%d.%d<3>IP_MASQ:reverse ICMP: failed checksum from %d.%d.%d.%d! <3>IP_MASQ:request control ADD for already controlled: %d.%d.%d.%d:%d to %d.%d.%d.%d:%d <3>IP_MASQ:request control DEL for uncontrolled: %d.%d.%d.%d:%d to %d.%d.%d.%d:%d <3>IP_MASQ:BUG control DEL with n=0 : %d.%d.%d.%d:%d to %d.%d.%d.%d:%d Prc FromIP FPrt ToIP TPrt Masq Init-seq Delta PDelta Expires (free=%d,%d,%d)%-127s %s %08X:%04X %08X:%04X %04X %08X %6d %6d %7luip_masq_usernet/ip_masq<3>IP_MASQ:Could not create "/proc/net/ip_masq" entry ip_masquerade L$Px0tcp$PT4udp$PT4icmp0$PT4ESPGREICMPTCPUDPIP_%d<3>IP_MASQ:register_ip_masq_app(): NULL arg <3>IP_MASQ:unregister_ip_masq_app(): NULL arg <3>IP_MASQ:unregister_ip_masq_app(): has %d attachments. failed <3>IP_MASQ:unregister_ip_masq_app(proto=%s,port=%u): not hashed! <3>IP_MASQ:ip_masq_app: tried to set n_attach < 0 for (proto=%s,port==%d) ip_masq_app object. <3>IP_MASQ:ip_masq_bind_app() called for already bound object. %-39s prot port n_attach name%-3s %-7u %-7d %-17s app<3>IP_MASQ:skb_replace(): no room left (from %p) ESPGREICMPTCPUDPIP_%d<3>IP_MASQ:register_ip_masq_mod(): NULL arg <3>IP_MASQ:register_ip_masq_mod(): NULL mmod_name <3>IP_MASQ:unregister_ip_masq_mod(): NULL arg <3>IP_MASQ:unregister_ip_masq_mod(): is in use by %d guys. failed <4>IP_MASQ:MASQ: unregistering "%s" while in lookup list.fixed.<3>IP_MASQ:unregister_ip_masq_mod(%s): not linked ip_masq_%s%d.%d.%d.%d%-127s Iface Destination Gateway Flags RefCnt Use Metric Source MTU Window IRTT TOS HHRef HHUptod SpecDst%s %08lX %08lX %8X %d %u %d %08lX %d %u %u %02X %d %1d %08X*dst cache overflow neighbour table overflow <7>ip_rt_bug: %08x -> %08x, %s ?<2>Bug in ip_route_input_slow(). Please, report mtu_expiresgc_elasticityerror_bursterror_costredirect_silenceredirect_numberredirect_loadgc_intervalgc_timeoutgc_min_intervalmax_sizegc_threshmax_delaymin_delayflushrt_cache$P0Pnet/rt_acct%4d: %08lX:%04X %08lX:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %u%4d: %08lX:%04X %08lX:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %lu%-127s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inodeTCP: inuse %d highest %d UDP: inuse %d highest %d RAW: inuse %d highest %d Ip: Forwarding DefaultTTL InReceives InHdrErrors InAddrErrors ForwDatagrams InUnknownProtos InDiscards InDelivers OutRequests OutDiscards OutNoRoutes ReasmTimeout ReasmReqds ReasmOKs ReasmFails FragOKs FragFails FragCreates Ip: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Icmp: InMsgs InErrors InDestUnreachs InTimeExcds InParmProbs InSrcQuenchs InRedirects InEchos InEchoReps InTimestamps InTimestampReps InAddrMasks InAddrMaskReps OutMsgs OutErrors OutDestUnreachs OutTimeExcds OutParmProbs OutSrcQuenchs OutRedirects OutEchos OutEchoReps OutTimestamps OutTimestampReps OutAddrMasks OutAddrMaskReps Icmp: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Tcp: RtoAlgorithm RtoMin RtoMax MaxConn ActiveOpens PassiveOpens AttemptFails EstabResets CurrEstab InSegs OutSegs RetransSegs InErrs OutRsts Tcp: %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu Udp: InDatagrams NoPorts InErrors OutDatagrams Udp: %lu %lu %lu %lu TcpExt: SyncookiesSent SyncookiesRecv SyncookiesFailed EmbryonicRsts PruneCalled RcvPruned OfoPruned OutOfWindowIcmps LockDroppedIcmps TcpExt: %lu %lu %lu %lu %lu %lu %lu %lu %lu <7>non CLOSE socket in time_done net_timer: timer expired - reason %d is unknown IGMPTCPUDPICMPESPGREICMPTCPUDPIP_%d<7>ip_input(): demasq recursion detected. Check masq modules configuration <6>source route option %d.%d.%d.%d -> %d.%d.%d.%d ip_evictor: memcount<6>Oversized IP packet from %d.%d.%d.%d. <6>Oversized packet received from %d.%d.%d.%d ESPGREICMPTCPUDPIP_%d<2>ip_forward(): Argh! Destination lost! igmp<7>tcp_readable: %p - <7>empty <7>got %lu bytes. <6>recvmsg bug: copied %X seq %X tcp_close: socket already locked! tcp_open_requesttcp_init: Cannot alloc open_request cache.tcp_bind_buckettcp_init: Cannot alloc tcp_bind_bucket cache.tcp_tw_buckettcp_init: Cannot alloc tcp_tw_bucket cache.Failed to allocate TCP established hash table Failed to allocate TCP bind hash table TCP: Hash tables configured (ehash %d bhash %d) tcp_parse_options: Illegal window scaling value %d >14 received.<7>Ack ignored %u %u tcp_fin: Impossible, sk->state=%d <7>ofo packet was already received <7>ofo requeuing : rcv_next %X seq %X - %X <7>retransmit received: seq %X <7>partial packet: rcv_next %X seq %X - %X <7>out of order segment: rcv_next %X seq %X - %X <7>*** tcp.c:tcp_data bug acked < copied <7>prune_queue: c=%x <7>seq:%d end:%d wup:%d wnd:%d <7>syn in established state <7>bad ack tcp_select_window: tp->window_clamp == 0. tcp_select_window: sk->mss fell to 0. <7>initial req->mss below 8 <7>tcpbug: unknown timer value <7>bug: tcp_reset_xmit_timer TIME_WRITE <7>bug: unknown timer value <7>tcp_v4_rechecksum: %x => %x <7>%s forgot to set AF_INET in tcp_v4_connect <6>possible SYN flooding on port %d. Sending cookies. <7>Reset on %p: Connect on dead socket. <4>tcp_v4_rebuild_header(): not valid sock addrs: saddr=%08X rcv_saddr=%08X <6>tcp_v4_rebuild_header(): shifting sk->saddr from %d.%d.%d.%d to %d.%d.%d.%d Failed to create the TCP control socket. <6>%s forgot to set AF_INET in raw sendmsg. Fix it! <4>%s forgot to set AF_INET in udp sendmsg. Fix it! <7>trying to ucast probe in NUD_INVALID <7>ARP: arp called for own IP address <7>arp_find is called with dst==NULL 0123456789ABCDEFIP address HW type Flags HW address Mask Device %-17s0x%-10x0x%-10x%s %-17s %s *00:00:00:00:00:00arpipv4ESPGREICMPTCPUDPIP_%d<7>icmp_send: destinationless packet <6>ICMP: %d.%d.%d.%d: fragmentation needed and DF set. <6>ICMP: %d.%d.%d.%d: Source Route Failed. <4>%d.%d.%d.%d sent an invalid ICMP error to a broadcast. <6>Wrong address mask %08X from %08X/%s Failed to create the ICMP control socket. ipv4<7>inetdev_event: bug netconfallhiddenlog_martiansbootp_relayproxy_arpaccept_source_routesend_redirectsrp_filtershared_mediasecure_redirectsaccept_redirectsmc_forwardingforwardingdefaultESPGREICMPTCPUDPIP_%dnet-pf-%d<6>%s uses obsolete (PF_INET,SOCK_PACKET) rarprawnetstatsnmpsockstattcpudp<6>NET4: Linux TCP/IP 1.0 for NET4.0 <2>inet_proto_init: panic <6>IP Protocols: %s%s, Idx Device : Count Querier Group Users Timer Reporter NONEV1V2%d %-10s: %5d %7s %08lX %5d %d:%08lX %d igmp_max_membershipsrouteicmp_echoreply_rateicmp_paramprob_rateicmp_timeexceed_rateicmp_destunreach_rateicmp_ignore_bogus_error_responsesicmp_echo_ignore_broadcastsicmp_echo_ignore_allip_local_port_rangetcp_max_syn_backlogtcp_rfc1337tcp_stdurgtcp_syncookiestcp_fin_timeouttcp_retries2tcp_retries1tcp_keepalive_probestcp_keepalive_timetcp_max_ka_probesipfrag_timeip_masq_udp_dlooseip_masq_debugip_always_defragip_dynaddripfrag_low_threshipfrag_high_threshtcp_syn_retriesip_no_pmtu_discip_autoconfigip_default_ttlip_forwardtcp_retrans_collapsetcp_sacktcp_window_scalingtcp_timestamps%-127s Iface Destination Gateway Flags RefCnt Use Metric Mask MTU Window IRTT<7>fib_add_ifaddr: bug: prim == NULL <7>fib_del_ifaddr: bug: prim == NULL route.$P$Q <7>impossible 102 %s %08X %08X %04X %d %u %d %08X %d %u %u** %08X %08X %04X %d %u %d %08X %d %u %uESPGREICMPTCPUDPIP_%dDENYACCEPTREJECTREDIRECTMASQ-RETURNUNKNOWN<6>Packet log: %s %s %d %s PROTO=%d %d.%d.%d.%d:%hu %d.%d.%d.%d:%hu L=%hu S=0x%2.2hX I=%hu F=0x%4.4hX T=%hu O=0x%8.8X %s(#%d) SYN <3>Chain backtrace: %s<-%s <4>ip_fw: packet drop due to netlink failure Suspect TCP fragment. Suspect short first fragment. <3>IP firewall: Loop detected at `%s'. Can't kmalloc for firewall chains. %9s %08X/%08X->%08X/%08X %.16s %X %X %u %-9u %-9u %-9u %-9u %u-%u %u-%u A%02X X%02X %08X %u %u %9s %s %s %i %u %u %u %u ip_fwchainsip_fwnamesinputforwardoutputUnable to register IP firewall. ip_fw_init: cannot initialize netlink ?dummy<4>DHCP/BOOTP: Ignoring device %s, MTU %d too small<3>IP-Config: Can't open %s <3>IP-Config: No such device: %s <3>IP-Config: No network devices available <3>IP-Config: Can't set interface address: Error %d <3>IP-Config: Can't set netmask: Error %d <3>IP-Config: Can't set broadcast address: Error %d <3>IP-Config: Gateway not on directly connected network <3>IP-Config: Can't add default route: Error %d <3>IP-Config: Can't guess netmask for %s IP-Config: Guessing netmask: %s #PROTO: %s DHCPBOOTPRARP#MANUAL domain %s nameserver %s pnp4$P <3>IP-Config: Not enough information IP-Config: Complete: device=%s, addr=%s, mask=%s, gw=%s, host=%s, domain=%s, nis-domain=%s, bootserver=%s, rootserver=%s, rootpath=%s offnone%08xNum RefCount Protocol Flags Type St Inode Path %p: %08X %08X %08lX %04X %02X %5ld<6>NET4: Unix domain sockets 1.0 for Linux NET4.0. <2>unix_proto_init: panic net/unixmax_dgram_qlendelete_delaydestroy_delay<7>netlink_release: impossible event. Please, report. sk Eth Pid Groups Rmem Wmem Dump Locks %p %-3d %-6d %08x %-8d %-8d %p %d<2>netlink_proto_init: panic net/netlinknetlink<3>netlink: unable to get major %d unknownunknownRPC: creating %s client for %s (xprt %p) bindwait8RPC: out of memory in rpc_create_client RPC: Couldn't create auth handle (flavor %d) RPC: shutting down %s client for %s rpc_shutdown_client: client %s, tasks=%d RPC: destroying %s client for %s RPC: rpc_release_client(%p, %d) rpc_release_client: %s client already free?? RPC: %4d call_reserve <5>%s: couldn't bind to server %s - %s. giving upretryingRPC: %4d call_reserveresult (status %d) call_reserveresult: status=%d, request=%p?? RPC: task timed out RPC: task has no request, exit EIO RPC: %4d call_allocate (status %d) RPC: buffer allocation failed for task %p RPC: %4d call_encode (status %d) <4>%s (vers %d): bad procedure number %d RPC: call_header failed, exit EIO <4>%s: can't encode arguments: %d RPC: %4d call_transmit (status %d) RPC: %4d call_receive (status %d) RPC: %4d call_status (status %d) %s: RPC call returned error %d RPC: %4d call_timeout (minor timeo) RPC: %4d call_timeout (major timeo) %s: server %s not responding, timed out %s: server %s not responding, still trying %s: task %d can't get a request slot RPC: %4d call_reconnect status %d RPC: %4d call_decode (status %d) %s: server %s OK %s: too small RPC reply size (%d bytes) RPC: %4d retry squashed uid RPC: %4d call_decode result %d RPC: %4d call_refresh RPC: %4d call_refreshresult (status %d) call_verify: not an RPC reply: %x call_verify: RPC call rejected: %x RPC: %4d call_verify: retry stale creds RPC: %4d call_verify: retry garbled creds call_verify: server requires stronger authentication. call_verify: unknown auth error: %x RPC: %4d call_verify: call rejected %d call_verify: auth check failed call_verify: server accept status: %x RPC: %4d call_verify: server saw garbage RPC: garbage, retrying %4d RPC: garbage, exit EIO unknownpacket data:RPC: xprt_sendmsg(%d) = %d <5>RPC: sendmsg returned error %d RPC: xprt_recvmsg(iov %p, len %d) = %d RPC: cong %08lx, cwnd was %08lx, now %08lx, time %ld ms RPC: cong %ld, cwnd was %ld, now %ld, time %ld ms <4>xprt_adjust_timeout: to_current = 0! RPC: disconnected transport %p RPC: %4d xprt_reconnect %p connected %d RPC: %4d closing old socket RPC: %4d connecting new socket RPC: TCP connect error %d! RPC: %4d connect status %d connected %d RPC: %4d xprt_reconn_status %d RPC: %4d xprt_reconn_timeout %d xprt_lookup_rqst: loop in Q! RPC: unknown XID %08x in reply. RPC: %4d has input (%d bytes) RPC: udp_data_ready... RPC: udp_data_ready client %p RPC: impossible RPC reply size %d! RPC: %4d received reply RPC: tcp_input_record RPC: reading header (%d bytes) RPC: empty TCP record. RPC: reclen %08x RPC: got xid %08x reclen %d morefrags %d RPC: %4d TCP receiving %d bytes RPC: %4d received reply complete RPC: TCP skipping %d bytes RPC: tcp_input_record done (off %d total %d copied %d) RPC: write space RPC: Write wakeup snd_sent =%d rpciod_tcp_dispatcher: Queue Running rpciod_tcp_dispatcher: Processing %p <4>RPC: unexpected error %d from tcp_input_record RPC: tcp_data_ready... Not a socket with xprt %p RPC: tcp_data_ready client %p RPC: state %x conn %d dead %d zapped %d RPC: xprt queue %p RPC: xprt queued already %p RPC: tcp_state_change client %p... RPC: %4d xprt_timer (%s request) pendingbackloggedRPC: %4d xprt_transmit(%x) RPC: %4d xprt_transmit reset timeo RPC: %4d TCP write queue full (task %d) <4>RPC: failed to add task to queue: error: %d! RPC: %4d xmit complete RPC: %4d xmit incomplete (%d left of %d) RPC: %4d transmit_status %d RPC: %4d xprt_receive RPC: %4d xprt_receive returns %d RPC: %4d xprt_reserve cong = %ld cwnd = %ld RPC: xprt_reserve waiting on backlog RPC: %4d xprt_reserve returns %d <3>RPC: %4d inconsistent free list (cong %ld cwnd %ld) <3>RPC: used rqst slot %p on free list! RPC: %4d reserved req %p xid %08x RPC: %4d release request %p RPC: task of released request still queued! RPC: (task is on %s) RPC: setting up %s transport... UDPTCPxprt_pendingHxprt_sendingHxprt_backlogHxprt_reconnIRPC: created transport %p RPC: Can't bind to reserved port (%d). RPC: xprt_create_socket(%08x, %s %d) udptcpRPC: can't create socket (%d). RPC: TCP connect failed (%d). RPC: xprt_create_proto called RPC: destroying transport %p unknownschedqchildqdelayq<4>RPC: doubly enqueued task! RPC: %4d added to queue %p "%s" RPC: %4d removed from queue %p "%s" RPC: %4d setting alarm for %lu ms <3>RPC: bad timeout value %ld - setting to 10 sec! RPC: %4d deleting timer <3>RPC: task w/ running timer in rpc_make_runnable!! <4>RPC: failed to add task to queue: error: %d! <3>rpciod: wot no daemon? RPC: %4d sleep_on(queue "%s" time %ld) RPC: %4d __rpc_wake_up (now %ld inh %d) <3>RPC: attempt to wake up non-existing task! RPC: __rpc_wake_up done RPC: %d timeout (default timer) RPC: wake_up_next(%p "%s") RPC: %4d rpc_execute flgs %x <4>RPC: rpc_execute called for sleeping task!! RPC: %4d sync task going to sleep <3>RPC: rpciod waiting on sync task! RPC: %4d sync task resuming RPC: %4d got signal RPC: %4d exit() = %d <6>RPC: execution inhibited! <4>RPC: %d tasks executed RPC: rpc_schedule enter RPC: rpc_schedule leave RPC: allocated buffer %p RPC: used last-ditch swap buffer RPC: %4d new task procpid %d RPC: %4d allocated task rpc_new_task: failed, users=%d, oneshot=%d RPC: %4d release task RPC: %4d freeing task RPC: killing all tasks for client %p rpciodRPC: rpciod starting (pid %d) RPC: rpciod running checking dispatch RPC: rpciod back to sleep RPC: switch to rpciod RPC: rpciod shutdown commences <3>rpciod: active tasks at shutdown?! RPC: rpciod exiting rpciod_killall: waiting for tasks to exit rpciod_up: pid %d, users %d <4>rpciod_up: no pid, %d users?? <4>rpciod_up: create thread failed, error=%d rpciod_down pid %d sema %d <4>rpciod_down: pid=%d, no users?? rpciod_down: Nothing to do! rpciod_down: waiting for pid %d to exit rpciod_down: caught signal -pid- proc flgs status -client- -prog- --rqstp- -timeout -rpcwait -action- --exit-- %05d %04d %04x %06d %8p %6d %8p %08ld %8s %8p %8p NFS: flgs=%08x, pid=%d, pg=%p, off=(%d, %d) name=%s/%s unknownRPC: gc'ing RPC credentials for auth %p RPC: rpcauth_gc_credcache looping! RPC: %4d looking up %s cred RPC: %4d matching %s cred %p RPC: %4d holding %s cred %p RPC: %4d releasing %s cred %p RPC: %4d marshaling %s cred %p RPC: %4d validating %s cred %p RPC: %4d refreshing %s cred %p RPC: %4d invalidating %s cred %p unknownRPC: creating NULL authenticator for client %p RPC: destroying NULL authenticator %p RPC: bad verf flavor: %ld RPC: bad verf size: %ld NULLunknownRPC: creating UNIX authenticator for client %p RPC: destroying UNIX authenticator %p RPC: allocating UNIX cred for uid %d gid %d RPC: allocating fake UNIX cred for uid %d gid %d RPC: bad verf flavor: %ld RPC: giant verf size: %ld UNIXunknownRPC: svc_destroy(%s, %d) svc_destroy: no threads for serv=%p! RPC: svc_register(%s, %s, %d) udptcpsvc: failed to encode reply svc: calling dispatcher svc: svc_process dropit svc: short len %d, dropping request svc: bad direction %d, dropping request svc: authentication failed (%d) svc: unknown program %d (me %d) svc: unknown version (%d) svc: unknown procedure (%d) svc: failed to decode args svc: service %p, releasing skb %p <3>svc_sock_enqueue: threads and sockets both waiting?? svc: socket %p busy, not enqueued svc: socket %p served by daemon %p <3>svc_sock_enqueue: server %p, rq_sock=%p! svc: socket %p put into queue svc: socket %p dequeued, inuse=%d <5>svc: sk_data negative! svc: socket %p re-enqueued after receive svc: socket %p re-enqueued after accept svc: releasing dead socket svc: daemon %p woken up. svc: socket %p sendto([%p %d... ], %d, %d) = %d svc: socket %p recvfrom(%p, %d) = %d svc: socket %p(inet %p), count=%d, busy=%d svc: recvfrom returned error %d svc: socket %p TCP (listen) state change %d svc: socket %p: no user data svc: socket %p TCP (connected) state change %d (svsk %p) svc: socket %p TCP data ready (svsk %p) svc: tcp_accept %p sock %p <4>%s: no more sockets! svc: tcp_accept %p allocated <4>%s: socket dup failed (err %d)! <4>%s: accept failed (err %d)! <4>%s: peername failed (err %d)! <4>%s: connect from unprivileged port: %s:%d%s: connect from %s:%04x svc: tcp_recv %p data %d conn %d close %d <5>RPC: bad TCP reclen %08lxsvc: TCP record, %d bytes svc: incomplete TCP record (%d of %d) svc: TCP complete record (%d bytes) RPC: TCP recvfrom got EAGAIN <5>%s: recvfrom returned errno %d setting up TCP socket for listening setting up TCP socket for reading svc: server %p waiting for data (to = %ld) <3>svc_recv: service %p, socket not NULL! <3>svc_recv: service %p, wait queue active! svc: server %p, no data yet svc: server %p, socket %p, inuse=%d svc: got len=%d svc: socket %p dropped request <4>NULL socket pointer in %s:%d svcsock.csvc: svc_setup_socket %p <4>svsk->sk_sk == NULL after svc_prot_init! svc: svc_setup_socket created %p (inet %p) svc: svc_create_socket(%s, %d, %08x:%d) <4>svc: only UDP and TCP sockets supported svc: svc_create_socket error = %d svc: svc_delete_socket(%p) <5>svc: server socket destroy delayed (sk_inuse: %d) svc: creating socket proto = %d svc: svc_authenticate (%d) svc: bad null cred svc: bad null verf unknownRPC: %4d rpc_getport(%s, %d, %d, %d) RPC: rpc_getport_external(%s, %d, %d, %d) RPC: %4d pmap_getport_done(status %d, port %d) RPC: registering (%d, %d, %d, %d) with portmapper. localhostRPC: couldn't create pmap client <4>RPC: failed to contact portmap (errno %d). RPC: registration status %d/%d RPC: xdr_encode_mapping(%d, %d, %d, %d) pmap_getpmap_unsetpmap_setpmap_nullportmapunknown%dnlm_debugnfsd_debugnfs_debugrpc_debugsunrpcunknownnet %d %d %d %d rpc %d %d %d proc%d %d %drpc %d %d %d %d %d RPC: registering /proc/net/rpc/%s RPC: registering /proc/net/rpc net/rpcRPC: unregistering /proc/net/rpc ipv4ethernet802unixcoreget_request(%d): impossible! <3>drive_stat_acct: cmd not R/W? <6>attempt to access beyond end of device <6>%s: rw=%d, want=%d, limit=%d <6>dev %s blksize=%d blocknr=%ld sector=%ld size=%ld count=%d <3>make_request: bad block dev cmd, must be R/W/RA/WA <3>ll_rw_block: Trying to read nonexistent block-device %s (%ld) <5>ll_rw_block: device %s: only %d-char blocks implemented (%lu) <5>Can't write to read-only device %s end_request: I/O error, dev %s (%s), sector %lu end_request: buffer-list destroyed FX2}dPFx2dQUANTUM FIREBALLQUANTUM LIGHTNING 730AQUANTUM LIGHTNING 540AQUANTUM LPS540AQUANTUM LPS365AQUANTUM LPS270AQUANTUM LPS210AQUANTUM LPS240AQUANTUM ELS170AQUANTUM ELS127AST3144AST3290AST3600AST3390AST3391AST3655AST3630AST3660AST5660ASAMSUNG SHD-3172ASAMSUNG SHD-3122ASAMSUNG SHD-3121AMaxtor 7540 AVMaxtor 7546 ATMaxtor 7345 ATMaxtor 7245 ATMaxtor 7213 ATMaxtor 7171 ATMaxtor 7131 ATWDC AC31200WDC AC31000WDC AC280WDC AC1210WDC AC1170WDC AC1270WDC AC2850WDC AC2120WDC AC21200WDC AC2200WDC AC2250WDC AC2340WDC AC2420WDC AC2540WDC AC2700Conner Peripherals 540MB - CFS540A!"89KODAK ATA_FLASHHitachi CVSunDisk SDCFBATA_FLASHHAGIWARA HPCide: Assuming %dMHz system bus speed for PIO modes%s ; override with idebus=xx%s: ide_set_handler: handler not null; old=%p, new=%p %s: ATAPI reset complete %s: ATAPI reset timed-out, status=0x%02x %s: reset timed-out, status=0x%02x %s: reset: success master: passedformatter device errorsector buffer errorECC circuitry errorcontrolling MPU errorerror (0x%02x?); slave: failed %s: %s: status=0x%02x { Busy DriveReady DeviceFault SeekComplete DataRequest CorrectedError Index Error }%s: %s: error=0x%02xDriveStatusError BadCRC BadSector UncorrectableError SectorIdNotFound TrackZeroNotFound AddrMarkNotFound , LBAsect=%ld, CHS=%d/%d/%d, sector=%lddrive_cmd%s: bad special flag: 0x%02x status timeoutstatus error%s: bad device number: %s %s%c: bad access: block=%ld, count=%ld %s: drive not ready for command %s: media type %d not supported ide_set_handler: timer was already active %s: Huh? nuking plugged queue ide_timer_expiry: hwgroup->drive was NULL %s: ide_timer_expiry: hwgroup->busy was 0 ?? %s: lost interrupt %s: timeout waiting for DMA irq timeout%s%s: unexpected interrupt, status=0x%02x, count=%ld (?)%s: ide_intr: hwgroup->busy was 0 ?? %s: ide_intr: huh? expected NULL handler on exit ide-probeide-diskide-cdide-tapeide-floppy%s: driver not present gd not in disk chain! %s: channel busy io_32bitkeepsettingsnice1pio_modeslowunmaskirqusing_dma01234567890123456789abcdefide_setup: %snonenoprobenowerrcdromserializeautotunenoautotuneswapdatabswapmmmmmmmHmmmide- -- USE "ide%d=serialize" INSTEAD -- BAD BUS SPEED! Expected value from 20 to 66resetdmafourqd6580ht6560bcmd640_vlbdtc2278umc8672ali14xxdc4030mmmmxnnnnnnnnnn -- SUPPORT NOT CONFIGURED IN THIS KERNEL -- BAD OPTION -- NOT SUPPORTED ON ide%d @%s [remap 0->1] [remap +63] [%d/%d/%d]capacitymajor minor #blocks name %4d %4d %10d %s ramdiskramdisk: request list destroyedramdisk: block not locked<6>RAMDISK: bad command: %d RAMDISK: Could not get major %dRAM disk driver initialized: %d RAM disks of %dK size <5>RAMDISK: Compressed image found at block %d <5>RAMDISK: romfs filesystem found at block %d <5>RAMDISK: Minix filesystem found at block %d <5>RAMDISK: ext2 filesystem found at block %d <5>RAMDISK: Couldn't find valid RAM disk image starting at %d. |/-\RAMDISK: image too big! (%d/%ld blocks) <3>RAMDISK: could not allocate buffer <3>RAMDISK: could not determine device size <5>RAMDISK: Loading %d blocks [%d disk%s] into ram disk... sdone disk #%d. Please insert disk #%d and press ENTER Error opening disk. Loading disk #%d... %cdone. <5>VFS: Insert root floppy disk to be loaded into RAM disk and press ENTER incomplete literal tree incomplete distance tree bad gzip magic numbersinternal error, invalid methodInput is encrypted Multi part input Input has invalid flags invalid compressed format (err=1)invalid compressed format (err=2)out of memoryinvalid compressed format (other)crc errorlength error<3>%s<3>RAMDISK: Couldn't allocate gzip buffer <3>RAMDISK: Couldn't allocate gzip window %s: %s, ATAPI CD-ROMoppypoypZIPcdrom or floppy?, assuming FLOPPYCDROMTAPEOPTICALUNKNOWN (type %d) drive ATA DISK drive %s: probing with STATUS(0x%02x) instead of ALTSTATUS(0x%02x) %s: IRQ probe failed (%ld) %s: no response (status = 0x%02x), resetting drive %s: no response (status = 0x%02x) %s: non-IDE drive, CHS=%d/%d/%d %s: ATAPI cdrom (?) %s: ERROR, PORTS ALREADY IN USE %s: ports already in use, skipping probe %s: reset %s: potential irq problem with %s and %s %s at 0x%03x-0x%03x,0x%03x on irq %d (%sed with %s)sharserializ ide%s: DISABLED, NO IRQ %s: request_fn NOT DEFINED %s: UNABLE TO GET MAJOR NUMBER %d %s: Disabled unable to get IRQ %d. %s: probed IRQ %d and default IRQ %d failed. %s: probed IRQ %d failed, using default. PCI_IDE82C693CS5530AL5229HPT343UM8886BFUM8886AW82C105AEC6210NS87415TRM290OPTI621XOPTI621HT6565CMD646SIS5513NS87410CMD640RZ1001RZ1000PDC20246VP_IDEPIIX4PIIX3PIIX<6>%s: ROM enabled at 0x%08lx %s: IRQ1 %d IRQ2 %d %s: port 0x%04lx already claimed by %s %s: too many IDE interfaces, no room in table %s: device not capable of full native PCI mode %s: placing both ports into native PCI mode %s: rewrite of PROGIF failed, wanted 0x%04x, got 0x%04x %s: Missing I/O address #%d, please report to %s: error accessing PCI regs %s: device disabled (BIOS) %s: device enabled (Linux) %s: not 100%% native mode: will probe irqs later %s: will probe irqs later %s: bad irq (%d): will probe later %s: 100%% native mode on irq %d %s: inconsistent baseregs (BIOS) for port %d, skipping %s: %s error updating PCICMD %s: %s Bus-Master DMA disabled (BIOS) %s: neither IDE port enabled (BIOS) %s: ignored by ide_scan_pci_device() (uses own driver) %s: unknown IDE controller on PCI bus %02x device %02x, VID=%04x, DID=%04x %s: IDE controller on PCI bus %02x dev %02x ST34342ACONNER CTT8000-ACONNER CTMA 4000Micropolis 2112AWDC AC31600HWDC AC33100HWDC AC32500HWDC AC22100HWDC AC11000H%s: dma_intr: bad DMA status dma_intr%s: misaligned DMA buffer %s: DMA table too small %s: empty DMA table? %s: Disabling (U)DMA for %s %s: DMA disabled ide_dmaproc: unsupported func: %d %s: BM-DMA at 0x%04lx-0x%04lx -- ERROR, PORT ADDRESSES ALREADY IN USE -- ERROR, UNABLE TO ALLOCATE PRD TABLE , BIOS settings: %s:%s, %s:%sDMApio %s: dma_base is invalid (0x%04lx) %s: simplex device: DMA forced %s: simplex device: DMA disabled set_dma_page%s: drive not ready for command %s: selected PIO mode %d (%dns) proc_ide: error: %s: '%s' /proc/ide/%s/config: channel(s) busy, cannot write not a PCI deviceexpected 'R' or 'P'bad/missing register numbermissing ':'bad data, 2/4/8 digits requiredexpected whitespace after datamisaligned accessbyteworddwordproc_ide_write_config: error writing %s at bus %02x dev %02x reg 0x%x value 0x%x proc_ide_write_config: error %d parse error pci bus %02x device %02x vid %04x did %04x channel %d proc_ide_read_config: error %d reading bus %02x dev %02x reg 0x%02x ??%c%02x%c(none) %s version %s (none)genericpcicmd640dtc2278ali14xxqd6580umc8672ht6560bpdc4030rz1000trm2904drives(unknown)%s %04x%cname value min max mode ---- ----- --- --- ---- %-24s%-16d%-16swrite-only%-16d%-16drw proc_ide_write_settings(): parse error %li physical %d/%d/%d logical %d/%d/%d %.40s disk cdrom tape floppy UNKNOWN settingsmodelmediaidentifydriveride%d/%smateconfigchannelidedriverside/driversread_intr%s: write_intr error1: nr_sectors=%ld, stat=0x%02x write_intr%s: buffer list corrupted (%ld, %ld, %d) multwrite_intrset_multmodeset_geometry_intrrecal_intr<3>%s: no DRQ after issuing %s MULTWRITEWRITE<3>%s: bad command: %d <3>%s: bad special flag: 0x%02x %i (none) %04x%csmart_thresholdssmart_valuesgeometrycachebios_cylbios_headbios_sectbswapmultcountnowerrbreada_readaheadfile_readaheadmax_kb_per_requestide-disk1.08<6>%s: %.40s, %ldMB w/%dkB Cache, CHS=%d/%d/%d, UDMA, (U)DMA, DMA <3>ide-disk: %s: Failed to register the driver with ide.c <3>%s: INVALID GEOMETRY: %d PHYSICAL HEADS? <6>SysRq: Keyboard mode set to XLATE SAK Resetting Power off Emergency Sync Emergency Remount R/O Show Regs Show State Show Memory Log level set to %d Terminate All Tasks Kill All Tasks Kill ALL Tasks (even init) unRaw saK Boot Off Sync Unmount showPc showTasks showMem loglevel0-8 tErm kIll killalL <6>%sing device %s ... RemountSyncSuperblock not found R/O error %d OK nothing to do <6>Done. %s%dNULL ttyWarning: bad magic number for tty struct (%s) in %s Warning: null TTY for (%s) in %s Warning: dev (%s) tty->count(%d) != #fd's(%d) in %s tty-ldisc-%dCouldn't open N_TTY ldisc for %s --- error %d.tty_check_change: tty->pgrp <= 0! do_tty_hangupdo_tty_hangup: N_TTY open: error %d tty_readtty_writeinit_dev: ldisc open failed, clearing slot %d release_devrelease_dev: bad idx when trying to free (%s) release_dev: driver.table[%d] not tty for (%s) release_dev: driver.termios[%d] not termios for (%s) release_dev: driver.termios_locked[%d] not termios_locked for (%s) release_dev: other->table[%d] not o_tty for (%s) release_dev: other->termios[%d] not o_termios for (%s) release_dev: other->termios_locked[%d] not o_termios_locked for (%s) release_dev: bad pty pointers release_dev: %s: read/write wait queue active! release_dev: bad pty slave count (%d) for %s release_dev: bad tty->count (%d) for %s tty_open<4>tty_io.c: process %d (%s) used obsolete /dev/%s - update software to use /dev/ttyS%d tty_polltty_fasynctty_ioctlUse of setserial/setrocket to set SPD_* flags is deprecated size of tty structure > PAGE_SIZE!/dev/ttyCouldn't register /dev/tty driver /dev/consoleCouldn't register /dev/console driver /dev/ptmxCouldn't register /dev/ptmx driver /dev/tty0Couldn't register /dev/tty0 driver %s: %d input overrun(s) %s: unknown flag %d n_tty_read_chan: called with read_buf == NULL?!? read_chan: tty->pgrp <= 0! n_ttyWarning?!? termios_locked is NULL. <3>%s: irq%d happened with irq_func NULL with %s as cad! memunable to get major %d for memory devs n;AvXaM ְdx vcsunable to get major %d for vcs devicertc<6>Real Time Clock Driver v%s 1.09<3>rtc: IRQ %d is not free. <6>rtc: lost some interrupts at %ldHz. rtc_time : %02d:%02d:%02d rtc_date : %04d-%02d-%02d rtc_epoch : %04lu alarm : %02d:**:%02d ** DST_enable : %s BCD : %s 24hr : %s square_wave : %s alarm_IRQ : %s update_IRQ : %s periodic_IRQ : %s periodic_freq : %ld batt_status : %s yesnookaydeadmaster pty_close: count = %d!! pty_ioctl called with NULL tty! pty_unix98_ioctl called with NULL tty! pty_masterptypty_slavettypCouldn't register pty driverCouldn't register pty slave driverpty: %d Unix98 ptys configured ptmptsCouldn't register Unix98 ptm driver major %dCouldn't register Unix98 pts driver major %dhead%3i %s char-major-%d-%dmiscunable to get major %d for misc devices <4>selection: kmalloc() failed <6>Watchdog: active, current timeout %d min. <6>Watchdog: shutdown. watchdog<6>NetWinder Watchdog sleeping. on (hardwired)onoff Thermostat: HI %i.%i, LO %i.%i; temperature: %i.%i C, fan %s. ONOFFON (hardwired)thermThermostat: HI %i.%i, LOW %i.%i; temperature: %i.%i C, fan %s temp<3>therm: unable to register /proc/therm <6>Thermostat: high %i.%i, low %i.%i, current %i.%i C, fan %s. %d nwbutton<6>NetWinder Button Driver Version %s (C) Alex Holden 1998. 0.3<4>nwbutton: Couldn't register device 10, %d. <4>nwbutton: IRQ %d is not free. nwled<6>NetWinder LED Driver <4>nwled: Couldn't register device 10, %d. eth7eth6eth5eth4eth3eth2eth1eth0loeth%dethether_setup: Ouch! Someone else took %s <7>loopback fed NULL data - splat ne2k-pci.c:vpre-1.00e 5/27/99 D. Becker/P. Gortmaker http://cesdis.gsfc.nasa.gov/linux/drivers/ne2k-pci.html Holtek HT80229Holtek HT80232WinbondSureCom NE34Via 86C926NetVin NV5000SCKTI ET32P2Compex RL2000Winbond 89C940RealTek RTL-8029<6>%s<6> The PCI BIOS has not enabled this NE2k clone! Updating PCI command %4.4x->%4.4x. <4> WARNING: The PCI BIOS assigned this PCI NE2k card to IRQ %d, which is unlikely to work!. <4> You should use the PCI BIOS setup to assign a valid IRQ line. ne2k-pci.c: PCI NE2000 clone '%s' at I/O %#lx, IRQ %d. <3>ne2k-pci: Probe of PCI card at %#lx failed. ne2k-pci: Card failure (no reset ack). !I    %s: unable to get memory for dev->priv. %s: %s found at %#lx, IRQ %d, %2.2X%s. :%s: Resetting the 8390 t=%ld...%s: ne2k_pci_reset_8390() did not complete. %s: DMAing conflict in ne2k_pci_get_8390_hdr [DMAstat:%d][irqlock:%d][intr:%d]. %s: DMAing conflict in ne2k_pci_block_input [DMAstat:%d][irqlock:%d][intr:%d]. %s: DMAing conflict in ne2k_pci_block_output.[DMAstat:%d][irqlock:%d][intr:%d] %s: timeout waiting for Tx RDC. 8390.c:v1.10cvs 9/23/94 Donald Becker (becker@cesdis.gsfc.nasa.gov) <0>%s: ei_open passed a non-existent device! <4>%s: xmit on stopped card <7>%s: Tx timed out, %s TSR=%#2x, ISR=%#2x, t=%d. lost interrupt?cable problem?excess collisions.<4>%s: Tx request while isr active. <7>%s: idle transmitter tx2=%d, lasttx=%d, txing=%d. <7>%s: idle transmitter, tx1=%d, lasttx=%d, txing=%d. <7>%s: No Tx buffers free! irq=%ld tx1=%d tx2=%d last=%d net_interrupt(): irq %d for unknown device. %s: Interrupted while interrupts are masked! isr=%#2x imr=%#2x. %s: Reentering the interrupt handler! isr=%#2x imr=%#2x. <7>%s: interrupt(isr=%#2.2x). <4>%s: interrupt from stopped card <4>%s: Too much work at interrupt, status %#2.2x <4>%s: unknown interrupt %#2x <3>%s: bogus last_tx_buffer %d, tx1=%d. %s: bogus last_tx_buffer %d, tx2=%d. <4>%s: unexpected TX-done interrupt, lasttx=%d. <3>%s: mismatched read page pointers %2x vs %2x. <7>%s: bogus packet size: %d, status=%#2x nxpg=%#2x. <7>%s: Couldn't allocate a sk_buff of size %d. <7>%s: bogus packet: status=%#2x nxpg=%#2x size=%d %s: next frame inconsistency, %#2x <7>%s: Receiver overrun. <6>%s: invalid multicast address length given. 8390.c: header struct mispacked <3>Hw. address read/write mismap %d <4>%s: trigger_send() called with the transmitter busy. set_dma_pagePCI: Enabling bus mastering for device %02x:%02x PCI: Increasing latency timer of device %02x:%02x to 64 PCI: Unable to handle 64-bit address for device %02x:%02x <3>pci: out of memory. <3>PCI: %02x:%02x [%04x/%04x/%06x] has unknown header type %02x, ignoring. <3>pci: out of memory for bridge. PCI: No PCI bus detected PCI: Probing PCI hardware reverse<3>PCI: Unknown option `%s' %02x%02x %04x%04x %x %08lxdevices%02x%02x.%xpciframe buffer device<3>fbcon_setup: No support for fontwidth %d <4>fbcon_setup: type %d (aux %d, depth %d) not supported fbcon_redraw_bmove width sy != dycyber2000%d %s fb%dfbunable to get major %d for fb devs scrollback:map:vc:offdummy deviceVGA8x16 <4>%s: no support for %dbpp Cyber2000Acorn8x8font,<3>CyberPro20x0: unknown parameter: %s CyberPro%4X%s: unable to map memory mapped IO %s: unable to map screen memory %s: no valid mode found %s: %ldkB VRAM, using %dx%d, %d.%03dkHz, %dHz redraw_screen: tty %d not allocated ?? [%d;%dR[?6c%c%c%ccon_write: tty %d not allocated vt_console_print: tty %d not allocated ?? ttyCouldn't register console driver Console: %s %s %dx%dcolourmono Console: switching consoles %d-%d to %s %s %dx%d to %s unblank_screen: tty %d not allocated ?? <3>keyboard.c: do_lowercase was called - impossible <3>do_fn called with value=%d 0123456789+-*/ ,.?()#pqrstuvwxylSRQMnnmPQSBDCASerial driver4.27TI16750ST16650V2ST16650cirrus16550A16550164508250unknownrs_stoprs_startserialserial shutdown: request_irq: error %d Couldn't reacquire IRQ. rs_put_charrs_flush_charsrs_writers_write_roomrs_chars_in_bufferrs_flush_bufferrs_send_charrs_throttlers_unthrottleserial(set)rs_breakrs_ioctlTIOCSER?WILD ioctl obsolete, ignored. rs_closers_close: bad serial port count; tty->count is 1, state->count is %d rs_close: bad serial port count for ttys%d: %d rs_wait_until_sentrs_hanguprs_open%d: uart:%s port:%X irq:%d |RTS|CTS|DTR|DSR|CD|RI baud:%d tx:%d rx:%d fe:%d pe:%d brk:%d oe:%d %s serinfo:1.0 driver:%s <6>%s version %s with no serial options enabled serial(auto)ttyScuaCouldn't register serial driver Couldn't register callout driver <6>ttyS%02d%s at 0x%04x (irq = %d) is a %s FourPortCouldn't configure serial #%d (port=%d,irq=%d): device already open register_serial(): autoconfig failed <6>tty%02d at 0x%04x (irq = %d) is a %s <6>tty%02d unloaded <4>Keyboard timed out[1] <6>keyboard: unknown e1 escape sequence <6>keyboard: unknown scancode e0 %02x <6>keyboard: unrecognized scancode (%02x) - ignored <3>pc_keyb: controller jammed (0x%02X). <4>Keyboard timeout[2] <4>keyboard: Too many NACKs -- noisy kbd cable? Keyboard failed self testKeyboard interface failed self testKeyboard reset failed, no ACKKeyboard reset failed, no PORDisable keyboard: no ACKEnable keyboard: no ACKSet rate: no ACKkeyboard<4>initialize_kbd: %s <6>Detected PS/2 Mouse Port. PS/2 Mousepsaux<4>NetWinder Floating Point Emulator V0.95 (c) 1998, 1999 Rebel.COM <7>NWFPE: %s[%d] takes exception %08x at %p from %08x "]6hE1+2F g - Z))Vy h40123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZkern_fp_enterfp_printkfp_send_sigkd_mksounddump_threaddump_fpuudelayxchg_strlocal_bh_countlocal_irq_count__ioremap__iounmapinit_mmkernel_threadsystem_revsystem_serial_lowsystem_serial_highenable_irqdisable_irqprocessor__machine_arch_typecsum_partial_copy__csum_ipv6_magicoutsboutswoutslinsbinswinslquicklists__bad_pmd__bad_pmd_kernelstrcpystrncpystrcatstrncatstrcmpstrncmpstrchrstrlenstrnlenstrspnstrpbrkstrtokstrrchrstrstrmemsetmemcpymemmovememcmpmemscan__memzero__arch_copy_from_user__arch_copy_to_user__arch_clear_user__arch_strnlen_user__gcc_bcmp__ashldi3__ashrdi3__cmpdi2__divdi3__divsi3__lshrdi3__moddi3__modsi3__muldi3__negdi2__ucmpdi2__udivdi3__udivmoddi4__udivsi3__umoddi3__umodsi3set_bittest_and_set_bitclear_bittest_and_clear_bitchange_bittest_and_change_bitfind_first_zero_bitfind_next_zero_bitelf_platformelf_hwcapsys_writesys_readsys_lseeksys_opensys_exitsys_wait4__down_failed__down_interruptible_failed__up_wakeupleds_eventdma_strenable_dmadisable_dmaset_dma_addrset_dma_countset_dma_modeget_dma_residueset_dma_sgset_dma_speedgpio_lockgpio_modify_opgpio_modify_iocpld_modifygpio_readcurrent_cplddequeue_signalflush_signalsforce_sigforce_sig_infokill_pgkill_pg_infokill_prockill_proc_infokill_slkill_sl_infonotify_parentrecalc_sigpendingsend_sigsend_sig_inforequest_moduleget_module_symbolget_optionsdo_mmapdo_munmapexit_mmexit_filesexit_fsexit_sighand__get_free_pagesfree_pages__free_pageskmem_find_general_cachepkmem_cache_createkmem_cache_shrinkkmem_cache_allockmem_cache_freekmallockfreekfree_svmallocvfreemem_mapremap_page_rangemax_mapnrhigh_memoryupdate_vm_cacheupdate_vm_cache_conditionalvmtruncatefind_vmaget_unmapped_areain_group_pin_egroup_pupdate_atimeget_superget_fs_typegetname__fputigrabiuniqueigetiget_in_useiput__nameilookup_dentryopen_nameisys_closed_alloc_rootd_deleted_validated_rehashd_invalidated_moved_instantiated_allocd_lookupd_pathhave_submounts__mark_inode_dirtyget_empty_filpinit_private_filefilp_openfilp_closefputput_filpcheck_disk_change__invalidate_buffersinvalidate_inodesinvalidate_inode_pagestruncate_inode_pagesfsync_devpermissioninode_setattrinode_change_okwrite_inode_nownotify_changeget_hardblocksizeset_blocksizegetblkbreadbreada__brelse__bforgetll_rw_block__wait_on_buffermark_buffer_uptodateadd_blkdev_randomnessgeneric_file_readgeneric_file_writegeneric_file_mmapgeneric_readpagefile_lock_tableposix_lock_fileposix_test_lockposix_block_lockposix_unblock_lockdputget_cached_pageput_cached_pageis_root_busyprune_dcacheshrink_dcache_sbshrink_dcache_parentfind_inode_numberis_subdirget_unused_fdvfs_rmdirvfs_unlinkvfs_rename__pollwaitROOT_DEVinode_generation_countdo_nfsservctlregister_chrdevunregister_chrdevregister_blkdevunregister_blkdevtty_register_drivertty_unregister_drivertty_std_termiosblock_readblock_writeblock_fsyncwait_for_requestblksize_sizehardsect_sizeblk_sizeblk_devis_read_onlyset_device_robmapsync_devget_blkfopsblkdev_openblkdev_releasegendisk_headresetup_one_devunplug_devicemake_requesttq_diskfind_bufferinit_buffermax_sectorsmax_segmentsmax_readaheadtty_hanguptty_wait_until_senttty_check_changetty_hung_up_ptty_flip_buffer_pushtty_get_baud_ratedo_SAKconsole_printregister_filesystemunregister_filesystemregister_binfmtunregister_binfmtsearch_binary_handlerprepare_binprmcompute_credsremove_arg_zerolookup_exec_domainregister_exec_domainunregister_exec_domainregister_sysctl_tableunregister_sysctl_tablesysctl_stringsysctl_intvecproc_dostringproc_dointvecproc_dointvec_jiffiesproc_dointvec_minmaxrequest_irqfree_irqbh_activebh_maskbh_mask_countbh_baseadd_timerdel_timermod_timertq_timertq_immediatetq_schedulertimer_activetimer_tableprobe_irq_onprobe_irq_offautoirq_setupautoirq_reportrequest_dmafree_dmadma_spin_lockcheck_regionrequest_regionrelease_region__wake_upsleep_onsleep_on_timeoutinterruptible_sleep_oninterruptible_sleep_on_timeoutscheduleschedule_timeoutjiffiesxtimedo_gettimeofdayloops_per_seckstatpanicprintksprintfvsprintfkdevnamebdevnamecdevnamesimple_strtoulsystem_utsnameuts_semsys_call_tablemachine_restartmachine_haltmachine_power_offregister_reboot_notifierunregister_reboot_notifier_ctypesecure_tcp_sequence_numberget_random_bytessecurebitscap_bsetsetup_arg_pagescopy_stringsdo_execveflush_old_execopen_dentryread_execsi_meminfoset_writetimesys_tz__wait_on_superfile_fsyncclear_inoderefile_buffernr_async_pages___strtokinit_fifofifo_inode_operationschrdev_inode_operationsblkdev_inode_operationsread_aheadget_hash_tableget_empty_inodeinsert_inode_hashremove_inode_hashmake_bad_inodeis_bad_inodeglobal_event__down__down_interruptible__down_trylock__upbrw_pageadd_mouse_randomnessfasync_helperdisk_nameget_write_accessput_write_accessregister_consoleunregister_consoleget_fast_timestrnicmpinit_task_unionproc_sys_rootproc_registerproc_unregistercreate_proc_entryremove_proc_entryproc_rootproc_root_fsproc_get_inodeproc_dir_inode_operationsproc_net_inode_operationsproc_netproc_busproc_scsiproc_scsi_inode_operationsdispatch_scsi_info_ptrlockd_uplockd_downnlmclnt_procnlmsvc_invalidate_clientnlmsvc_opslockdctlnlmsvc_grace_periodnlmsvc_timeoutregister_nlsunregister_nlsunload_nlsfind_nlsload_nlsload_nls_defaultutf8_mbtowcutf8_mbstowcsutf8_wctombutf8_wcstombsdev_lockctskb_over_panicskb_under_panicsock_registersock_unregistermemcpy_fromiovecmemcpy_tokerneliovecsock_createsock_allocsock_releasesock_setsockoptsock_getsockoptsock_sendmsgsock_recvmsgsk_allocsk_freesock_wake_asyncsock_alloc_send_skbsock_init_datasock_no_dupsock_no_releasesock_no_bindsock_no_connectsock_no_socketpairsock_no_acceptsock_no_getnamesock_no_pollsock_no_ioctlsock_no_listensock_no_shutdownsock_no_getsockoptsock_no_setsockoptsock_no_fcntlsock_no_sendmsgsock_no_recvmsgsock_rfreesock_wfreesock_wmallocsock_rmallocsock_rspaceskb_recv_datagramskb_free_datagramskb_copy_datagramskb_copy_datagram_iovecskb_realloc_headroomdatagram_pollput_cmsgnet_familiessock_kmallocsock_kfree_sskb_queue_locksk_run_filterneigh_table_initneigh_table_clear__neigh_lookupneigh_resolve_outputneigh_connected_outputneigh_update__neigh_event_sendneigh_event_nsneigh_ifdownneigh_sysctl_registerpneigh_lookuppneigh_enqueueneigh_destroyneigh_parms_allocneigh_parms_releaseneigh_rand_reach_timeneigh_compat_outputdst_alloc__dst_freedst_totaldst_destroynet_ratelimitnet_randomnet_srandom__scm_destroy__scm_sendscm_fp_dupmax_filesdo_mknodmemcpy_toioveccsum_partialmake_8023_clientdestroy_8023_clientmake_EII_clientdestroy_EII_clientsklist_destroy_socketsklist_insert_socketscm_detach_fdsinet_add_protocolinet_del_protocolrarp_ioctl_hookip_route_inputip_route_outputicmp_sendip_options_compilearp_sendarp_broken_opsip_id_countip_send_checkip_fragmentinet_family_opsin_atonip_mc_inc_groupip_mc_dec_group__ip_finish_outputinet_dgram_opsip_cmsg_recv__release_sockinet_addr_typeip_rt_ioctldevinet_ioctlip_statisticsnetlink_set_errnetlink_broadcastnetlink_unicastnetlink_kernel_createnetlink_dump_startnetlink_acknetlink_attachnetlink_detachnetlink_postrtattr_parsertnetlink_links__rta_fillrtnetlink_dump_ifinfortnl_wlockctrtnlneigh_deleteneigh_addneigh_dump_infortnl_waitrtnl_rlockctrtnl_lockrtnl_unlockipv4_configdev_openin_ntoaip_rcvarp_rcvarp_tblarp_findei_openei_closeei_interruptethdev_initNS8390_initregister_netdevice_notifierunregister_netdevice_notifierregister_inetaddr_notifierunregister_inetaddr_notifierloopback_devregister_netdeviceunregister_netdeviceregister_netdevunregister_netdevnetdev_state_changeether_setupdev_new_indexdev_get_by_indexeth_type_transinit_etherdevdev_set_allmultidev_set_promiscuitysklist_remove_socketeth_copy_and_sumalloc_skb__kfree_skbskb_cloneskb_copynetif_rxdev_add_packdev_remove_packdev_getdev_allocdev_alloc_namedev_ioctldev_queue_xmitnetdev_droppingdev_basedev_closedev_mc_adddev_mc_deletedev_mc_uploadn_tty_ioctltty_register_ldisckill_fasyncif_port_textsysctl_wmem_maxsysctl_rmem_maxltalk_setupqdisc_destroyqdisc_resetqdisc_restartqdisc_headqdisc_create_dfltnoop_qdiscpfifo_qdisc_opsregister_qdiscunregister_qdiscqdisc_get_rtabqdisc_put_rtabqdisc_new_estimatorqdisc_kill_estimatortcf_policetcf_police_locatetcf_police_destroytcf_police_dumpregister_tcf_proto_opsunregister_tcf_proto_opsregister_gifconfregister_firewallunregister_firewallcall_in_firewallcall_out_firewallcall_fw_firewallregister_8022_clientunregister_8022_clientregister_snap_clientunregister_snap_clientip_masq_get_debug_levelip_masq_newip_masq_listenip_masq_free_portsip_masq_out_getip_masq_in_getip_masq_putip_masq_control_addip_masq_control_delip_masq_control_getip_masq_user_hookip_masq_state_nameip_masq_select_addr__ip_masq_lockip_masq_m_tableip_masq_s_tableip_masq_d_tableip_masq_haship_masq_unhash__ip_masq_out_get__ip_masq_in_getip_masq_get_dynaddr__ip_masq_set_expireregister_ip_masq_appunregister_ip_masq_appip_masq_skb_replaceregister_ip_masq_proto_modunregister_ip_masq_proto_modregister_ip_masq_modunregister_ip_masq_modip_masq_mod_lkp_linkip_masq_mod_lkp_unlinkms_not_foundms_discard_pktrpc_allocaterpc_freerpc_executerpc_init_taskrpc_release_taskrpc_sleep_onrpc_wake_up_nextrpc_wake_up_taskrpc_new_childrpc_run_childrpciod_downrpciod_uprpc_create_clientrpc_destroy_clientrpc_shutdown_clientrpc_killall_tasksrpc_do_callrpc_call_setuprpc_clnt_sigmaskrpc_clnt_sigunmaskrpc_delayrpc_restart_callxprt_create_protoxprt_destroyxprt_set_timeoutrpcauth_registerrpcauth_unregisterrpcauth_init_credcacherpcauth_free_credcacherpcauth_insert_credcacherpcauth_lookupcredrpcauth_matchcredrpcauth_releasecredsvc_createsvc_create_threadsvc_exit_threadsvc_destroysvc_dropsvc_processsvc_recvsvc_wake_upsvc_makesockrpc_proc_initrpc_proc_registerrpc_register_sysctlrpc_proc_unregisterrpc_proc_readsvc_proc_registersvc_proc_unregistersvc_proc_readxdr_encode_stringxdr_decode_stringxdr_decode_netobjxdr_encode_netobjxdr_zeroxdr_onerpc_successrpc_garbage_argsrpc_system_errrpc_debugnfs_debugnfsd_debugnlm_debugio_request_lockend_that_request_firstend_that_request_lastblkelv_ioctlide_hwifside_register_moduleide_unregister_moduleide_spin_wait_hwgroupdrive_is_flashcardide_timer_expiryide_intride_geninitide_fopside_get_queuedo_ide0_requestide_add_generic_settingsdo_ide1_requestdo_ide2_requestdo_ide3_requestide_scan_deviceside_register_subdriveride_unregister_subdriveride_input_dataide_output_dataatapi_input_bytesatapi_output_byteside_set_handleride_dump_statuside_erroride_fixstringide_wait_statide_do_resetide_init_drive_cmdide_do_drive_cmdide_end_drive_cmdide_end_requestide_revalidate_diskide_cmdide_wait_cmdide_stall_queueide_add_proc_entrieside_remove_proc_entriesproc_ide_read_geometryide_add_settingide_remove_settingide_register_hwide_registeride_unregisteride_setup_portsmisc_registermisc_deregisterset_selectionpaste_selectionpcibios_presentpcibios_read_config_bytepcibios_read_config_wordpcibios_read_config_dwordpcibios_write_config_bytepcibios_write_config_wordpcibios_write_config_dwordpci_read_config_bytepci_read_config_wordpci_read_config_dwordpci_write_config_bytepci_write_config_wordpci_write_config_dwordpci_devicespci_rootpci_find_classpci_find_devicepci_find_slotpci_set_masterpci_proc_attach_devicepci_proc_detach_devicepcibios_find_classpcibios_find_devicefb_displayfbcon_redraw_bmovefbcon_dummyfb_confb_alloc_cmapfb_copy_cmapfb_get_cmapfb_set_cmapfb_default_cmapfb_invert_cmapsregister_framebufferunregister_framebuffer__swapbitsfbcon_cfb8fbcon_cfb8_setupfbcon_cfb8_bmovefbcon_cfb8_clearfbcon_cfb8_putcfbcon_cfb8_putcsfbcon_cfb8_revcfbcon_cfb8_clear_marginsfbcon_cfb16fbcon_cfb16_setupfbcon_cfb16_bmovefbcon_cfb16_clearfbcon_cfb16_putcfbcon_cfb16_putcsfbcon_cfb16_revcfbcon_cfb16_clear_marginsfbcon_cfb24fbcon_cfb24_setupfbcon_cfb24_bmovefbcon_cfb24_clearfbcon_cfb24_putcfbcon_cfb24_putcsfbcon_cfb24_revcfbcon_cfb24_clear_marginsfbcon_vgafbcon_vga_setupfbcon_vga_bmovefbcon_vga_clearfbcon_vga_putcfbcon_vga_putcsfbcon_vga_revccyber2000fb_attachcyber2000fb_detachcolor_tabledefault_reddefault_grndefault_bluvideo_font_heightvideo_scan_linesvc_resizetake_over_consolegive_up_consolehandle_scancoderegister_serialunregister_serial_memcpy_fromio_memcpy_toio_memset_io0B`PBhPOpPO|POPOPpPPPPPPPPPPPPQPQP(QP XP Y Y YP Y ,Yx 4Y [$A [A [B [TC [XC [C \F \tG \G (\G (\tH 4\xH 4\M <\M <\N H\N H\xQ T\|Q T\Q \\Q \\Q d\Q d\T l\0\ t\`>>>(C4(JDJPO\hpHķPطHm4mtX ,`8,`DP`,|\Id4xĸԸ   ,< HT dHt80DĹdԹܹܼܵ,S<PL\dXpVxW0X`R$RpP:̺#)x/1$345<X8DL4To\,doxoL$ȻԻ/X/ (0\8@HxPh\`d@l|Lxtzy{pȼp{ؼ xvx|(u l`0М@؃T `Llt48,ؽȕ(8PHD\lt\|P< ܝT Ծ(<eL\^\WlW$o$0tq̿sܿPvx~L~("8p&D3P I\uhćtDܗ p `5 ,X8 DXh#xd  lHuL>̓ h (0T<HTd t  h   Զ (8LdXt4\d{|~(|8H(`h&x'dehen nPxQQQc o'((8 H Xh8t`Iut|uh$$0@RDpL|qTGdZt |/*x&GdHL,, ,0L|Bh@ ph Qnpx0,Ԓ (e(x0@LhXqh|CxV<,'(܊L`,<0RL\d|DH   :Xti$P"4 @hP(`@p$HPu uu$X0Lddp|LXpt 4(@<HhXdظt33\>= , P%$4D'T(`L h,x2P0x0000000 00,0<0P0d0xh1p1x)0))8*+LBDEdE(<:@EXIhut*\+Mԟp0tē,<P`بp<؞h 4$0<hLX`GdGtLX=Ldȿ/.(K@DPȏdx`qx  @`0 OH $\I 4|DXh-xTR U  tx x     $ 04 @t P̫`vph<Pv0w`D$w wT(XY(HO4Ԕ< D`L T ` hԩ t  [[4   (u$v8 P `Xt tWt ii\.l4,68l7D8P_\TVhVx4WhXXLp]d Z zyx   (d><HX h x0 D@hpP \0D\h|dd$8dLd|4 T. /4p0H\p6@wpXx  (4H7L7dE|MMGGXGF,<: L; \9 hG tD= 2 4 4 > > D C   p 0? D X d t 5 P , - ( I (J J J 4P L,M h|M |4N X pZ D[ ,Y y \ s d  ( @ 0X D XT l | Ȑ | ܋ 0 l ܫ $8dHhTl`plxX D ( +( t T   , @D LlXX d t<    ` \  в  (| 8 L `, ph   $ $ T 4   , ` $ 4f Dg \lc t   \ 4 d s s u } 0H@|\xHx  ȸ  0 HH `| x 8@   p     8( 4 H T\l|dp#$ 4)P)*$X+8,H-\t-lx../12\33  (`545H6\8p9;8<H==<@@AB$X_4_H \ h t,!66x #%0T(x8td      DReswapper@8@H@FA"F? dAd@@@@0`D`8`b Linux(none)2.2.16-20000713#2 Thu Aug 17 16:31:21 EDT 2000arm(none)d f @"hhP. jnpooooooooooooooooxopoho`oXoPoHo@o8o0o(o oooo4p(ppp    sJ$|s J$|s$J$|smOsmP Xk Ac8'@  0{,{({${ {{ |cctdH}Pd`i xf|e|e~~e~0mxg,mj(m mlmHlm,nmXnG@$d؂RH@$dЂH@$dĂH@dI@dd|ni|d||d|pn~hn | \n$|!PQ|"HX|)@P(fT&8|Hq |@ă$( ,r| q |q | q | o| q|ȇ$|ȇ$|u| $|| T$| |X|p$|d|T$|t/sbin/modprobe\2????$ph $  @ @4, ؋̋8qTmO8q8q <0q0q0` <K |(@ \ dddp``̝ĝ\\|tld@\PD  l  X   X    t      X    t   tS-XXXXXXXXXXXXXXXXXXXXXXXX,XXXXXXXXHHX ԈԈTT@@ 335 5DJablq܉جKf|glmmqhK`hl\4$Xl@@XL\mAԎ$dmAD@l$t$|$ȟ$$ @$$$$ $ $ $(mA$$$$  $$$$ ",$ @tmAD$|$ܛhhh@A  $ $ $ $<LĚĚ8$,$0$x<D@НH8(4tt  " !@|''(3(-@)ؤ)9L;l:5`95:< |@4FhFD5OO55dZYbaa(\\<[lcD5VWXxeLf -_?$B'EzFttp@hpxH\4qxHPp@DrT 4pT(rsLp@ XwxH\xT@rH yH@XzH@zHD\xT@rH P|$}(p X̤Ԡ<LL0T H \4  PpTxTDxlxh`xdxpPDpp `pp Ppx Ppx Ppx Ppx Ppx Pp Pp Pp Pp8x8xDxLpppH<,x \,\ \\| l,\ L< $, ЩЩȫд    !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~|D0||@|$p0 H $ p     8 0 (P ? (| |p|`|L|< , |,$Ph.d} | | | |    | | | t | h | \ P |D |8 |0 m( mm$ m<`Dй,noop noqueue pfifo_fast$\4pfifo,LdbfifoL dh d \ X T  _.p..p .0up         | h \ t      H|`$PTA0up d`SdUHggxag0u}E@(t hht||$hh h ,| (| 0| |4| p8|`<|T@h,E  h |H  @      ԔL $PN PF    2 S8| +|?+|+mA+|\ @] ///// \  1P 1P d P0P H d < h  < L 000  P0P ؼ d 0h E< 0 000  666|P0   00 E000000 d < d  H \ 0J8J@JtTP `Q Q Q Q Q R R  UR S LS U U V W X  < `0 0 `8 X `8 X `8 0 4`@$ad ah  al ap Q0amxbm,bm bmLbmamfffffffff|fpfdfXfLf@f4f$fffeeeeeeeexepehe`eXePeHe@e0e eeeddddddxV4hmtmo$b  8 H X 4  T  X      #+3;CScscc !1Aa  0@` ??  P< ||||}}|||P$d e D^ <$he 4$d (L_ ` t$] lY T d$T] 4$\ $v $lc x Є`w  o Xs s @t v Pt t  @4lԌ ؓ d P Ԍ P 2Kn,X` %K @B`%&-g5 =T\ t ( X ` (  ` x ` < D ` L D L h (   h  , D 9 9 ? D   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*!!!!/%123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $% $%% %%<%%%$%4%,%%d"e"`":&;&e&f&c&`&" %%%B&@&j&k&<&%%!< %!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~# #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:&;&e&f&%c&`&" %%%B&@&j&k&<&%%%%!< %!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJK*!LMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#+! #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%&!")"a"e"d" #!#H""" %lS S ^ 4U ] ] < ,,0r    ($$    ̓X  DĎ  L T` \D d( l  t |   || H _$ p ZZZ D  L   8 p p<      UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU   < L \ $ , 4 l   >|!"P#@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?4)P)*X+,-t-x../12\33`55689;8<==<@@ABBB4C4C4C4C4C4C4C4C4C4C4C4C~~~~l|88||8<<<<~~<<<><~~<fffffffff{|`8ll8 |<~~<~<~~< 0``0(ll(88||||88<<<fff$lllllll||| 0`Ɔ8ll8vv000` 000000 0 0f<l8l||||`0||0xv`0v~ x|||||8ld`````ff<~~~p0`x |v 08<0`||0`vvffffffv~8ll8|0000`|`bfl0`܆ >`bfl0fΚ?<<<6ll6l6lDDDDDDDDUUUUUUUUwwwwwwww66666666666666666666666666666666666666666666666666666666666666666666666666666667666666666666670??07666666666666666666666666667076666666666666666666666666666666666666666666??66666666666666666666666vvxllllll`00`~pffffff|``v~ffff<~~~~`0``|```0|~~0  0~ 0`0 ~p~vv8ll8 ll<l66666?     >     @${[]}\qwrtyuiop~sghjklzxvnm    |                   1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./      <              d,d-d.d/d0d1d2[[A[[B[[C[[D[[E[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~[1~[2~[3~[4~[5~[6~h7h7m7r7w7|777777777777777777777777`A`a'A'a^A^a~A~a"A"aOAoa0A0aAAaaAEae,C,c`E`e'E'e^E^e"E"e`I`i'I'i^I^i"I"i-D-d~N~n`O`o'O'o^O^o~O~o"O"o/O/o`U`u'U'u^U^u"U"u'Y'yTHthss"yszijD1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./* 789-456+1230 /|}~z{YxZ[\]^_|y`abcdqrstuefghi|jvklmno}~p46@7\443ܬHAP?@@@@?@?@@@@?$@?@@@@@? A33UU UU (((((AAAAAABBBBBB