ELFa( 44 (  L!Y:pL i7aH !   7W6L877L5@5(L0O!T4: 0@OID0)00000 O*0" 0 BP" @ 5 &2 9g S+ 0060IM\M Error: 4P PEp` `5$Z:!,:! :!:!@OPD@pP5 ,@Tp'y -LKM K/P 00꼟7 -L`px 0P`dP0@ 0P`p0SW  1 L1:! 0-L@0P@, t00P@ p0,R200SR  >Q  0,R200SR0707L1V6 p-L`TP^0@ D0PP p0PU:pM!M! - LaA:0wP00S0 @ 0T @A(0S 0 #Q00 `0pB@000T @+(0S 000 r P0LL111'- 0200!!!,&bwT17J5p1CY -0LS 000PJ5 -0LS 000PJ5 -0LS 005 -0LS 005 -`0LSP @ T0C "+P +@TUq"+@P @"+P +@TU U:T00 t/P`0`P=+P X T0aZ0S a`T0 0!TJ51p7|J5 - 1MLvK[v9. i,  0@T 0  c0@" 00! r0@6 B   +SPvLL <=?0  &; 4L5177|5 `77871P! 0-@LPT:0M!4N! -L$ =?00$ " `J5 -L$W6 -@4@P PP0@@0DD0L@ 0009,0( 00@7@L5HY!LL5Y! -L 84"1>3,0 0 HL\dL5џNOР a`!^!^!`_!^!^!^!^!^!^!^!^!^!^!^!^!dџNOР a`!^!^!_!^!^!^!^!^!^!^!^!^!^!^!^!ПNOР ab!^!ПOР aa!^!^!`!^!^!^!^!^!^!^!^!^!^!^!^!^c!L5L5L5xp@-,O~P~P,#ODO00Pp -L -鈢LrP@ "0iQ00HHbHRH"H2,Ÿ4"@0200 "00"`0 PP000 aP@ "0P` 000ڨap Q@ "`00PP000l 80DXXaXQX1X!1@    "`0KPP000aQP@ "`0gPP0000  ̠ 0N 00 00  S.8St}8鸫54Z6n!h!i!8i! h!h!j!j!$k!L5l!m! m! l!m!Lm!L5L5 -L0g6 -L0 0g6 - L00L5 -@P`ࠟ0LpT*0 0S $@T*00ST:t00  0t 00 @0000 0Q,:!7g6l1K51:!$A!0177 0-@L0PT *0S ,@T*0ST:L_t [t\ ,0,(,&0 Rt0:!؞1:!711 -L0 M40 80 0 @, 8M5800 S80 4 \,, J-P& Z40J S040 ,PK,+, a0p@S+`00a 0 q 000,0\,0 0000,1 -L -L -LM8 <@ 0D$0 L0p<@0C@0Y, 1 0 R' 0 P @@D 1 `P@1!0 Ɇ 0R:$ 0R⾆< 0R:@ 0R8Ⳇ 0Y, 0S 0l00夆,  0 TT坆,  0 8<喆,  0 $叆I58Q55415Q5Q5Q5 -LPKh1lM0 '0lA0`p00 ` 7 0 40$S`\  K0 V 0 S `LsV& 1 0L00P00T00X R0 H 0! !7@D8 0p 0005S<0 Q00 ! Vx 06 $=!7g6@1D1777M5PJ54|0 hh0h h@80d0< D0+X0L0$& 03JI5P!|57W6L8 -L6-? 300 3? -L@  ZP 04@8001! -LP`0U0p#F*0 R0 0 ! "&R:Q1R0aSP!* 0`V:U FK801 -L ` p0M,  0`V0`V/* P0S00!!@0T0S0J F0 00. "&P! 0S5,0S01,0 P 0`V:h 0`V,0WC*@0S `$ @0`V:0P (501 7 -L -LT@pP0`L  a<8P)7&3!/R5 L8@ -LXK`@Mn\ \ 5` `D d 0PU>\ U h 0u  ?F+(501p0d1e2c 僑 00 h W@0 R0   @0pW0dUd `\@ 0 PhU`\ 0dQ  FR5(501 -L@Ph 4M$      `(0S N\!\0H >#P >T kD` ^1L0 #4PK@@Kp `1 pRpna0<40 &B,B0 0@ 00 0^ %% D00Hx= 1c2cP1!& "L T= 1c2c1!& "$0(A!(5R507(77 -"B MLŸ1= 1c2c1> !1! `2b48"B! !0 `aS1plc P!&eᘡ'u0(,` 0p U LAtaYM@ P0U00Q U*q4a1= 1c2c>#"&1@"A#00CZ0 U00:p0 @T0pPd` 0 P0""60p0@Th h!pLX, 00p(A!7R5(|5(77P!L8P! (5@ g6187111 -0@00L 00 hM0?L5L5 -0@00L 00 VM0?L5L5 -(( L0 00/L5L5 -LM, @ 0 #+>;0 %4 !, C0 8 !0, `$* 0Q>C~ 80R ~20M$5JJ4 ? M46S8046S  Z*D0Z2`0P8 00J $:FMZ#I50, `$* 0Q>C~ 80R <20M$5JJ4 ? M ZI5* -L`P  @@:`@ 0 @0qV 0S 0  0 0@ 0^20$ 0 0@0C 0000A0P @;M U00V03S &: f-M ! P`3F?6C#jjVWLI5 0- 0L@P@ 0P 0 -LX! M0`ZU0 0 XD* P01j2c,0 p 0S4 0 R0@0QQ! 1= 1c2c1>#"&" 1=>  1c2c1 ,04 !.  a040 0>0 P pX: 00Z(5R5( -LP A!B! -0 L  LI5B !O =  -L0!\\0X?0?0 c0/ 0Cs0 / !05 -0L 0S n ! n`0P300p3020d0=C0  060 & 050 + ? 0X#60"! S#0008 000 i01ܽ1  -@0 L  0 04"000鸫55t -L@  @4" 1>3 0P <7 -0 !L 74H - L00DL5! p-|Lx @ %?10$ ``PPH0  <m00,  :p鄖7!517 -L0(M0 0忹0PclX1 h6d1 -L ,3H." 0-| LxP=?0S@ <0S Xl mL0H 0C00<D0< 0<0@000 5@@5D177 -xLt@ pl04 1Q̋L D<  !000!I57 5"4"" -0 L 鸟7 5 -L@ M@:@A0Pk@ :@40Pk$@ :@'0Pk@@ |:@p0Pdk@ T:@ H0P<k17117 1,1781\17l1171 -L @m&阠7 -PM0L00C S ,1 0 ,K,K %0K0@K %,P)PK!PP00[ P̀0S 00C S ;&00Pp `R @ )%P0 R @PU0pSU 00P2 `0P17(5 -0 L0b10h5405 p-LL`@HP ~P@T@  =~ 9~p餬"07p"0" -Lp M U$0!e\10!0 (0L00pP00W  @K<`$KP#P(K#P꠭556d1ܭ5 -0LⓁ7p5 -L@ (M@:@0Pj1(61$ R 00,65 p-L@:PS`*@P:41  |  0 [P@T0 @:2kP$~j 0 ` p$7,71L1 0-L0| M0PPP   X000\@C H0C00KG R$$"@(s.$,P06D520 -0M L@ R 00<`KԐpРP̀ 'P :P僷P ?0 00C00 'P :Pi R (,? 0S87@5<522,62 -L -L 01# 0-\LX@ @bQ@@&  PU0  0(7D0 -L` \0b#v |0 b "V!FT` ?0TWD ?@T * P "k@T: 22 -L\Pp 0"F0c#fil `?0TkP Y?.0 #6"FcT * PuJ?@T: 2 -LM0 P, @ Q vB 3?0T4  T:0$S@D@4@ 4 , 00CL0#6. ",40 8 4@T*` 1"Q *Q *0!3Q:0@  @T:4Q 4 00S: >, \/ R, 000S' 08 0C@ Tx >dY* 0 0 0&` a>0#00  0 B 6` 0:#: 0 2000C0 *0"* f0@0T *@P 4 >0@0T:Y   2 -L1L!pL0P@S, > 0`"C X*0 R`D@ V:P 0`"6C !X1=1c2c>#p0"&"A*00c `0D@"6C1>0#V:000( 2R5 -Lz - 0L0 - 0L0 -L -$L 00 W,5 7@7 -L 0h,50 -L 0,50 -L[,5 -LpX0`@PT @0 0P(0@T =(70D 2? -L, @P =0 2N -D00L S*4 00 S* 00 00877 -4LLi(@$ n/ j/4 2d#(# -LxBtrM40 0 P, `0 41`V Q `1`V c i@@pp 2U ,0P1"#"AP 0`DP1,P0 P0!0@00t U, b2b48"B! *`p`m( (`,000@@D@T:  b2b48"B041h Q,0Rq@1c hpa00,    0  0 WP8 d L0 J+@00PU *P7 72((748255ĺ5|1 UP!P\0 00`0  00V00 "0!ᰠ00080 *0X0 0@@ <D`V:P`(@@@P00p70 ,0 @ ` V8Xq,p_`00Sp S к5P5(7S xx y<,N0S TX p<A`, @0SA`,0S`01PpW2 - $ M  0  L,5(7 -L\` PKXp@M @lP 4g@@gTg긺542 2<2 -L@p`MP\10000 K00{ Y=p1 R@010@ 0+0T (7, -LⲂ -L @0qS a*@P:4#Q E 00 000P@DT: 2jg0S|e R*\0 R: L1 R,0 R6668,2t,266 p-LP(M@P c000\DD0 0:ㆰ,0P  *c6 66P2DP2lP2%6xP2 -L t(M : k0Pc,V264V2 -L@ (M@0@U0PbW26W2 -L5 -L5 0-PPL@P @t  $0R @0 5L7 -LWp$Lh0dL\LT0PLH0DL<04 L,0b27b2b27b2@7b287b27 -LKP tKl0hK`0@T LP D04@808 LP (04@80Tn2Xn2 6dn2$6pn2&|n2& p-Q! 0LS `0 @KP8@4`0 Q KP00 K0P 0 00:100 R i| KP l0l 00010iT KP D0D 80< p(6P5s255t27577 t25`7t2#\# -L -LP5 0-LP @0000C ST 0bS 0Q.SQ@ Q 0S:S :S00 0o0K! -Lp, P; $A00PP3 =`P @00@P P0S  0@ @P tP0S (0 00(0 PP0S 8^P $ &0302hH!J!hJ!42 -Lj@PM_00,( ,00C`1 4 080<05 @ 0D0H |0|ppANK @DAnK `F\0{xDP (E]dE@3@5@3 -L (hB35 -4L0 @P %] 00 E35E3(u7 0-L@8PP 1!Q3@>T00p8 0-t0 L  P`@ \"P  P 0@4   0鸫5w7I3J3 `0! 0R 8CR *0R'U* U  \ 0U00 \08060$0pp 00U&00 T \D\!p00!pK3L3`LL35`PL3L3 -2LŸ \Bn011||2|"0  !l2@ !001DRD"00$ 0@00"02D P0("(2T X0 " 2` d0"2h l0"2p t0"2x 0"2| 0!1 0!1 0!1 0101 0X !0110(Pp Z @P Z`PxA`P(Pl1l!0203#00h00HPDP@P>OV EV eV oV<<$0L2 1cAk0S `00@00  0P P0@@4 00 00 0C 0w7z7S -L[6 -L04K! -(0L  0   -Ld@p @T -LOPq @T -L=P P P!<P<<<PP<P< <(0PP TP3tP3P3P3P3 -L M01@@000.000w0C0" @Dt1@d 00 @DtD0 R P ,Z(G$0 F  4K!P3)P3 p-L@0P `S V P 0SP 0Sp 0-@ PLU0P& P! P |P lP \P L0U DP 4P0lK!|K!tK!DK!LK!K!TK!dK! -(@0LS 0SK! -L -L -L 0-@==X0 w PP0 0 0 % % 1?5h0L1\\00_0S `0 \K000 D  Q=#X0%0*Գ,@,,,87`* -LCp0 006` 5@P  !0d000 000  !0 00h $ 9Pg 0-LP@00!?080<0040! PU 00 0 0C80<0400!?0 -L8@ <03S YY8< 03S`080<%0, 0@!9<0 R!(  9Y`3`3$6a3 -L`PPM?`P ,#00S03Y P080 < @p 0$("<0"( @Tp0@SS @T0SS Tt@X0@C@TZ8< 0$ 0(0, 0s,080< 0 * 8S00R0S ! , Y (0S 8<00 0 0(0((0!0Cx@$0S @q@@Dt  P$ $0S,X[p,0 q 0X@X@XTuX`0SdP` ;`d n?$p` 03@P(@ x0k00h h0 0` `0 1X X0D 0$6|$6Xa3\a3$6$6a3a3b3b3b3 b3 *5 *@* * *l**$ BX (b3 -LL0 LR 0@0rG@TG 000$6xV4z7z7 0-L@PP PUd0 -LP`Mp,0 =PDV 0@S `XP8 0@S`P&A1101@P0xS1S $6$6121@P,0 `V  0;S,SP@P0S  -L`C M!P0=S  P  P  PlW`0hS0dS0`ShS4ßlKC aLp02gQ \NP@P T0lS0uS0nS0 K0MP900S1 >`ZW;lK0 K0=Pc\!D!,!! ! !!!!!!!p!d! ! ! !h!000000 20 00" " $W0|@0 000d 0@00000004000 890098000 000 0 ,[( [00 20iS0dS0eS0bS "0uS0sS0 K0P0 0B.S00$ p3q3q3 q3q38q3q3ll3r3z7XV00B0S@K8L 0 K$B0`0pFgQ@ 0 S2Svt tWyt t/0F 2c!RgV 0 S_ ! ! !l !| ! ! ! ! !0 ! !D !T !\ !202W2H 02V2402Q0 " 0@0 0@ "G0"@0 0@ 0 "=0' 2c12R202" ".202)00?0,0 0(0 `0@H,p 0PA@0S p( "2002   ,r3r38ll3s3Ds3V VTs3ll3 -L -Lfbk_ p-|P@LTlVh0@E` 00PP`L@00002 F_`VZpz7ps38z78z7 -L KM} 0R  Xk1%6 k*l*Ulu3 -L  LM=?0 +IdKu\ 1R`0SUA0$Px1ps kF@0l`KDQT8  000  $000,0,8@<@@0DTPPP 0L0 !>$0 0@D PH0 0PK0,0 \w PDP@0T 6[8c88l0 )t P 8jDD E@t0LU 143d3&6&6&6*Խ* 3&63H0@D0 R @4N=P $04@80 0 &6X'6Ȋ3*&6 -<0<LU000U(0(< 0'63'6Ĕ37Д3X'6 - L(MU<K7|4 3R T2  2"2"P RT2@K@0 2P H P@KD@ 0HKP|Tp"00S/x!!!!!!!!!!!!!!!!;IXgv FϠ\1T{`0@Tj*p \X`#1LC9"SK/ƒ#1C:"àT0t 44x0. 30P0K 0 #| 2e1YT 8 2l1Z T>.>6 22l1Z T+3 5 <3`31h35z7'6'63HC+{733 @3z7MbK/((`Dp0@T:, ,0,oPT{7'6h3 -L KM<{ 0R  i1@(6Y+[+S3 -L -L -LLSDD@S@0| R :003P3,6h77 -L PM : 域<0P0S,00 S  0 x37387,6,6,6S0 ,6,6 -L@0 ,0M0:@n0P RH3E,7\3"000Q7 0-L( K$M PP 0S8@K (0S$0[.0K(0S2[3K(0S080 (0S040 0 p-L R" 00 0 @ PZ@T1 00@0 !000!%P 40S P 0`009@00`<s@0S<10v,@T`@T Q0S 00 0000 00C 0 !00C0 R  !R 0`@T0 :P|0 0@p :P `04@80XT0 @ydD udpt$6A5@^,p773xn,3o,`f,/6g, -L@ :P 04@803l, -L/6 0-L( K$M@ PP 0S8@K (0S$0[.0K(0S2[3K(0S080 (0S040 -0 -L@ M@:@M0P(P0P娀娠p 0"'S*@Rx`:41 C0 X  B0B ᜰP@DTP  P4L66487H7D7L707$4 R #/R0 R  00R000CP0 !00P0 0020Ypp0p 0 d0@ X 0000Wp@0@  :P ,0 0 T4D7487,, 66774, 0-LTKHM*D0S 000D0S 000D0Sd 0C10 (L: 垝@0@P4@0, 000p964T7$:67 :60 -L':6 -L8@ HM@:@r42P(P@ :@e 2P P\@ :@X1PO1Qԁa 0%S*@Rq:4#2 C 0   B0B ᩯP@DTPLO 0P $!0  0P:41ST0ᅯ0S@TZSO0P !0 0PT#90l ll0 0D` :\00;0#"408"4@"448P"4"488"487B50;68"4"4H <6 ;6<;6T d50 000 S10R! @04 $0< 0 b RA<@0 0C S0S $0T@0  -L 41>3HMA HMAHM AHMA<@  HMX!H4P【 ! !@iHMpHP4@`DH`` &d&d&d&b&a lO@iHMTp`HP4@ a !@iL5L5L5L5L5HM(@<0`C p, ! jHMp@<`H$pDH`` &d&d&d&b&a lO@VVGHM,A<`Hp㸐⭦ኦ0\A嚯! rHMA<`H p! d0  V@iЍpVV@Q0 1@ !i"?"d>">"?"(@"`@"@"",#X"""|"dC%0$"$","Hh! ""t"""8h!#$ %$"|%"0"Ph!M#""h!'"Xh!p$8 $`$$x$$"L"0"h""d"""#"$"h""$"@$d""""7%"""""""""""""""""""""""""""""""""""""""  Y` 0 )_o0x c0+  X 7  < (PO--Ӏӑ #/ i -0L   -0L   -L0 00 -0L   -LXTP 0 @D  0 0,  0 0 0077 -L0`^PU$ 唀p 0 000P50 00 @U4 o@T0^PU|g6xg6 -@00 0,L(00   |g6xg6 -L(@$  000|g6xg6 0-L@L0 P 0 0 0  !0X X0T00 0 0 0 0 07|g67xg6 -0PL`UV U @p4 1@TV @P 0D3 1@6T0 P`UV  -L1@0 00 -LQ@0 00  -L -L -L1@0 00 -LQ@0 00  -Lpl0`P@ @4  h i  0 @@4$ -L -L@0! 000 !4Z6 -L@0!$ 0000 !4Z6 -LP 㜠0BpT `01PZP \ @PT 00 iR,0, Ph4Z61171tg61 -L|0@P<0Q:0Q *0D 0S0 4<00<  0071 -LPiUF4bp$$0 00  !0@0T0$ 0`  000!0 `@T   !00S   0R0C0 N$ 000~<4Z6p77tg6P1 -LP0p 0`0!"0@0Q 0 0!0QXP L- 0R00@0 0!DZ64Z6 -LPiUp 0" W00` 㡊@P ` `00PP 4Z6 -Li^   0 t<100@0!  P 0S  P;!4Z6p11 -L`00!@Pp0   0 R00 0`@iT00! 0 0bS00bS00!@D0   `F00@iT00!4Z67 -L00! <2  p iR00!4Z6 - 0L00g6 - 0L0C0g6 -L=?0 $ c \\`Xp@T@0SP0S ._갚7|!DL5 -L 0 DL5 -L$ 00S DL57 -LP@+0sS, 00$@@Dt;L51 p-@0M00040<L,8 @P;($ 0; 0:  0:z Z c0C0vVUnN:`P=?0 @|0\`p @  PPT1`:D/?: 1d1111181D111<141Q5H1p -Lp`@D Mh00S S S fPdPePp1?P 0 000pp @R ? :W`d :ꐘ1 -L4P (H 0 0C0g6g6 -4 0LS00 0H0ؘg6g6 -L -LM?@#0 60 -L -LpH X0`X2X(@FPP4( h (  $00$0Chb! 0-L#^M?@0S t 80 0-L@0Pl040?, 8\X< 0C#6L0L@0T0" 30" `30"!P~ 3n#6T0H H0 -L@,x00S _F 0-LP =?0P 0S0 3ʀS HP D@ R:RP:P00S 0/";" -0LPXg6 -L~ 8!< -L !4  ~-8 0 !3<0 3 2Q }!}!}!}!0Pp -L~ 80# Q ,~!4~!<~!D~!0Pp -L`$R0pM 0 Z R R Rj RO R : S@~=80@ Q. ( Q Q Q Q Q ~Q! Q Q vQ Q pQ m0j0$h0`f0dd0b00_0`0\0d0Y0W V0S0Q!0SNG@  o @@`$B9B S7 0@ P0P  Q@ "R0%TQ0EPPP K04VUU33ppA3sQ 0 0  -L@`pM0PS ʃ  0VP`` 00$ K40$ VP``V P000Z81 -L@~=80$ KM  t PP P 5P p-L`PP-? 0P00L4,;|"#;AP@T l0 ST !X20X2! P\w Pb=?0Tp h0 !$1R(1R 1R 041Q 81Q!1 01Q 17 0 <000 RG 0D00  !0S H L0L0LH0H0 R00 R 00HL0L0L H@L@00 0S0@0@00! P0P 0S P = ?0R 0P !X20CX2X"R  !R p7 5 -M?@0L0S0X0 5)XP  0X0 -L#* -LP(KP0M}?p,p  00 0@K"00s.00!    gE#00  !T)"00  !  B!000 o!V`00!@Y.#`_* -LP,K0Mm?`0`  40 4@K!000.00!   p@ !000 /!R gE#00  !)!00  !0S 00 !000!00! @  .# * -L@0! 0 0!000 /!R#)! -LP$K00Mm?`(`  ,0 Q,@K-pgE#00 R(0S @0! @ !R -@ -LP$K00Mm?`(`  ,0 #,@K-pgE#"00 R|(0S @0! @ !R -0@S#) -LP$K0Mm?`(`  ,0 ! ! ,@KI-0pS@@0S>(0SW-00gE# -LP$K0Mm?`(`  ,0 ! !!+,@K'-0pS"@@0S (0S&-00gE# -L@ !0 0!S  B#)ě1 -L@ !0 0!S  B#(ě1 -0LM0 ` 0 @'͌|8 |111%6ctt0@ dd0@ TT0T @0@fꠚ7g67|1J51CYѴ1g6ğ17؟177 0-L P=?0 @03^2P  0P00 0P 0P  0P@8S S 00P 0P 0P0 P0 -L',@M00!?2> K 0 #203. 030   00! $`KPp p' P  p-LQ`M=? 0 PK 0 3R@  5^ ) 07< 0  !2>( K KP32> #03 0   00! 00& P p -L@Q(M =?0 03Q 008 0$0 R3 0  P-0   0   \$KT8 K 0T0^0S =?0 03Q   800P 000\   400,0 -L 0 0  0  0 0  0  $0  (0  ,0 00 $ 40 ( 80 , <0 0 @0 4 D0 8 H0 < L @  00@0! p-L`MM4P?@@ 0 \0 3R  70 Q1KT PP+ 07< 0  !2> K3.2> 03 0   00!P RU !U   p p-L`MM4P?@8 0 0 3R1 K P+ 07< 0  !2> K3.2> 03 0   00!9P RU U   p -L 0@0@0 @0@0@ 0@$0@(0@ ,0$@00@(40,@80@0<04@@0@8D0<@H0@@L0?`20d0\BP0@  -L`pM 4P?,  8<#0aSP P 0\E \0 3R5  @E 0@``Ex00T0S 0S , R1,0048`0<0 0@0@ w000@0Q,  R00 - -L`M}4P?p, 00  8<#0aSP P 0E 0 3RBEt@E0E@ M``00`E /` E0 !0`@@Ex00}V0S 0S , R1,0048@0<0 0@0@ 000@0Q,  R00  p-LPM`  0%0S000#00! ?2N 3$# 0 $# F 30 203. Ð03 0   00!p -pM@0L m0?`S2>0 BT lᨐK00!2 @00!T 0- T+ X@00 $RU LX@T T X 0T @ 0l  2D2!2!   411#0CP T 0<PʰPWl0S 0DS40!0!0!0!0!0!L!L!0!L!L!L!L!L!!!!!!!L!0!0!L!L!!L!L!0!p9P00X@0#H`#xr0P3ΈD0 102. #030   ?0;0;0S <R 0CR  r 000D <0 0C<00 pZ p0S @0 rR 0RD <0 0C<0Z Z p-L@ `KMPP=?0  03Q \ Pp -L P$MM?@ 0 0 3R@K  \^7, P P10D0 40@<P8"v0 kܡPP! ,00!^ !A9K ` 0p\,0D 0! !>U RDP -LM-? 003Q K  ^ K0  -L x@PŸ` @MP񟗝x!!!!!!!!!!!!!!!!!!!!Ш!X!d!x! ֓ Y|^y p=?0 03 Q pW j 0d 0|^W^Y -? 0$pK 03Q \ G`$ 0 :@0 `39,5 q0W  (0KϝP' =?0 0 3R(00=?0 R 0ᵝV  $ ᭚ -L0 40) -LQ40) -L0 40(A -LP`p>@t 00@|7 -L =?0 ! -L@`[ pM嚠`P$ M?@,00!^ !AKP0 00[,0@0! !V   -Lp0 P 7 -Lp@`T*tpP-T030#T03S L-D-U4-P@U-T:騥11111 -L`p@QP*444 U0#03U01 S%++ 0S e`10 SpLp@U0#03U03S 0ES e`#`10SpAp@ -? 0E03Q0 0S@@\}-T @TD`DTr-@T(m- j-|5̇ 711111 -Lm?`00!T0P0Q-DN-7#l J$0E-@0< p?-HP@P pG6-U*1-@.-W E:&-,@pTp-  P p-:T*l- -W @9<C00! 85إ111$1,1P11p1|111 -@0L  -L`plMM?@#l038    1  01?1>38 -0L@^ 4 R 80C Q 0a/! !00dS @P ^x5 p-0P``P L*%: @1@*%U_ O@KT@*L* @*Q  $* *pI511ܬ11̬1Ĭ11 -LpPZ`@PT  R*0`00SJ . 00#0 W`V V V 101101l0`S+(00(00 #  ? l0"0lSh0 "0R* 0000n00h  h 0  l00l00S  -H0L 0 \ 0S I5 -L`vpM]?P,h1 RKZI @!^ !AK  0c! !X"# @0@*x# ) 5@< #80)\bd0`2 @ K0 x` 00 .\bd0`2@0 <0P <0`0 \ VX!) @ b 5 pp711ĭ11p1ԭ1 -LP` p0@ 0@ 0@ xx0@ hh0@ @@e@T@CT@@@PPܭ1g61g61g61g61g6 1g6 -LM@<3 /4000- 000< P0,0 %6p,0Q %8<  AW Q JQT Q E2":S"000u20S6`4 "000 ,0"b0a4 @@fP @0,< ) 0 40!00#40@00Z @ 1  <  B~'j&j0a ` @R30 R R `R c 6c VcS`1`vc$000 @@f (P @0< ( 0W  ,  48<11#( #0#40ZV5 4!'L5g6g6g6D1g6x11g611`1$` !000540 &0  `40S@DP @0< o(ZZ0@ p   0, W , 4 8<11#( #0#40@p00S Z@f  @Dg614 0DR@C A<0, 0b<0 -L@0?# 0!(ԯ1 -L`P0< 0U!p M?@ 0(,d @0@LP0S @'@0S  P11ԭ1tR51 -L  p-<0 L<@,`?P@Tp77 -@(L ]D@p01 -@(L f4@!`01 -L` p0PS @T 00  `00C0@T 000`000C0x0S7 -Ls'Æ1 m'@p`0P0U  !n"b0 2 0p0P R@0F`DQ: ^h?'`<'X9'P6'H3'@0@/'r817D1(5R5(<\1p111171 -PpLU0e#*`1= 1c2c>#x"& @"A00~Z0U00:00XS   & P!(g6R5P1ش1 0-@PP00 L 卅,P0P :40000g65 -L#PP= 1 8* `Vp@T 00  00C0TF@ D\ @?0KT 0?0 OI57 0-LPP R  T. O*0 @K0@000騶17 -LPpY`@VT K gDl@D o -LPp*`@VT K 8D!=@! P -L @ p-=?0,0LS 0S40 P@(`@PUpI5 0-L@40PS R$ , R 040@4P01 -4 LR 0S4 40 4 -pPLU- `0!@ 0  s    8#8S@(@$@"@!PP@ # 0R!0<ᣌ@`0!X T   00!ڃ00!!1 -Lp@1= 1c2c>#"&H"D1 `Q1=S !c"b! a2a48A\@@T6 0+ 0( 0    7q@0! 0RA P `V !J!{( % %R5(<11<1 -L>xR5 -LxR5 -L`\1PP\ *< :>0n`0FEpp@+PP7  P. @ǠL|1= 1c2c>#P0"&"1   D0L|:GPU*#ZU:V p71R5( -L -40L @R q p71 0-L@PR!!!!8 00 v0鴹1 -L,M ) 00  8 i, 4 <8Y*4 R 0^4d,0f8 0<0 0i0S6#@0 < 00 f< 0D0 &6 PR|0@pT 00  00C0T  D!  VI57?0;P PDF<@ 0fpWv#f0S #D0JPT:&j@jV:0S 0p4H R@4  ) ,0S 0H R0S ) 0S.8  4@ Yu:.1 57 -L@P0CP#3UX `0\ p@00PdmmP  ` 07Pm -Lm?0@ )Q@- !ER @- !RXP0QRt< 0!RXQ! 4Ġ!Ɍ 0 12 3Ġ!Ɍ 0 1Ō 0 12 0A S:6 :6 P20A S: : @Q::6 PA Q : : @QZ/A Q : : @Q:: P:0?6 P?0?16?X1Ġ   " Ɍ 0 10Ġ   " Ɍ 0 1Ō 0 1 :!.  P.U.  :IntelStrongARM-110StrongARM-1100StrongARM-11105555`!|!!!!,!!!! !`!!!!! !@!`!!@!`!!!`!|!!!!! !!! !!!!!! !@!`!!@!`!!!!!armv4v4 -L H 008 000 $ 000 00077 -0L0cC30CS. P0 PS0 S ^ 00 0C`00 0C0 7 p-LP @T( R1 00S. R`j00000, P 0S 000c00p` Vj P 00R@ 0 0 00  0fS00 0p 0-P00L@S0C00T 00CS 0 R0S0000c000S 0 C$0S 7p0 -0L ,  (  -LpP@<`à 0S ( 0 P@T 71 -LP0pM0PC` 0!!Q PUUp #``H" 0@P P$@(@ 00@ 715t! 0 00ܿ1 -0L3$ 7 -40#LPS00R0C0 7 -L<0P@0!,R( ! 7 -LPpC^ .oP `` `PPpP0!0S 0S ! 7 0-L0@S0@Ã0P !0S 00S 0S 0S0 P 00000!0 7 -L0@$ S# 00{ 7 -L0@$ S# 00p 7 p-t0LC` !PU P00 000( 00R g!U @oPTp 7 0-L@Tp#0PS\0 =0DS6000 71 p-L`0!A 0R 00cS"0 R/P0S0 0000@T 0nS }>0\ 00nS \ 0 0bS!pܫ55ث521 -LPp00! 1 R< R1P  0 0000! 0R `0S0 00000@ T 0lS x M}>0 R S 0SR0000!ܫ5ث521 -LM 0!,  ! 00 00 a q@ P 0    !0 0S 0S 0b/R@0 T0& @0|`S@p0 P 000080PU@ 0dS0 }>05ܫ5ث521$$ 0@0000,0! -(0LQ 0 bܫ5 p-P`L0@SM P400#PeP P005!11p -Lp W@`P*40S 80S.P |<0S80S 40S 0  ?30p 40040 0?3 0pA 800800Ut11H 0-LQ0@SP<@T0@8@4@ 40S TPRP0C400 <0S0@@8@4@ 80S TPRP0C800! <0 -LX@PM, @ > p 0!00!Q ,Q`"t0p@P  XS`"@0p@P ,0P$@(@  1 7 1!81  0 00p1 7 -L% -L -L 0-LP@KCM0 7 -LNp?!P* 0#100CS4!@!H!P!4!4! $0$ "! z11 -L0! Ph!!l!!!$!H!!!\!\!!8!\!: 0 R|!00Lhh: 0 DDD: 0 ; 1 6!09#10 -(0 ' 0:"0  090  09x0  h 0:T0  D 0:00 ,$ 0:00$0 !h6h65 -Lc@k@Dt00!@ @@000,00 B000 B -L @I@Dt 50  -@@@0L8 60602@Dt 60  -L3΀ 030 00 ! 8#8SA(A$A"A!A p-0 00@0LT 8P8`@!k !00C0!Tp̟7 h6 -L00 -L@Ô00!\ 03 !00C0 R  !R (0 j0000!7 -L@3 0S 0  \ -L0!?H#D@! -L@0!-? 0@33D32> Ò03 0! -L`P F1 32N @pT 0S p@T F 020`000 000S0p0S 0pjx !00C0!V@T 0S @TF0 10 h6̟7 p-L0`M?@@ÔP\  EH1 32 D 0P0pU  {PP3.2> Ô03 0   p -LpP G2  12 02 0@Q \`0S0S0@@0i !00C0!@Q̟7 h6 -L -LQ Q" 0SP?x x0R $1(S !S 1S S 1  0<0P -LQ0@1 QP0@ S \!\!!|!|!|!\!!!!!\! -L02 N1 32 P -L@ @ P$!!!!!!!!!!!!!!0S50X0lifc_ -LTa@P1pP ^41h@T0 !000! 0@U@ U pP= P?0l  p 0 0  0S   UWU 0S G   0 1 0̟75 h6 p-LP@/`P2 E1 32 00 p -Lp@@TP,pP(pT% 3S" `0!A%PT3 D1 32 p!0 0S u p-LP`@0!#R!pE 1 0S002 0 <04 #03 0   ! p -LPp`RP@L0PH@T p0S UPPH@ T 5 -LPp`R\@X0PH@T 0S x0S `UPPH@ T 5 -LpR=?0p |@P0`H@T l0S =?0T  6`pPH@ TV\ lL4,;@ #;! R l0 SR  57 -L0R  -L 9 -L0R ^ -L0R s -LN4.;H#; R \ l0S\  7 0-LP@! 0@CT0 -LpMp 00 @l00 ! 00 0X P0 `Q Q ,PV$PBdPE P0 P$P  K` 1 -L -LpS`Mt^Q pP? 0(K 0 3R@ kPU_(07<(0  !2>0 KpV V V p00, ($0(0 00, ($0(0 $ K2>3.2> 03 0   00!W#XX 00!-? 20K00!@ p 0 0 3R -\p 0-L0@TM 00!?PK 3$#04Ñ00  00! 0 0 3R \ 000 -L -LPUM ` 3@? 0K 0 3R @T07< V 00   0K 0 3R \ 1R0Sw00!@KKPXV  0K!@Q! & `1 /A b 11!\0S  0S5 2^0 3M?@K $#3~ 0 3 $#` #030   00! 00!KKP #030   00!^ @P KdP @ɚ;Gk_k R @@ -LM 00 0 ?l0 0  1K|0  p-L@P`M? 0 0 3RK @T 0SE4%; #;!` 7 R l0SR Kp -LP0E?SpW U UM?@^11C` 00W)  07< 00S S0EUS00!P 3.2> 03 0   00! -Lp@Q M =?08<#( R  0aS0#030$0 \- ? 0 P 0 3R00S5 `R10R-0R)83 P<#0cS # 3R PE^` P P:8c<T P=?0  03Q(K R\P -L -L`pQMC ? 0$PK 0 3R@  ^H$07<$0  ! #V( V V $00$00$0 33.2> 03 0   00!XWW =?0 #@(  0(K 0 3R \ -L`Sp@P(M5T =?0  03Q0K \ "T0KD@KU  `0U0V0S =?0  03Q \  -L=?0  -L00!?  2003. 030   00! -L14 K(M  K0 x40P -LL4,;< #;! R l0 SR 27 -L$Ð4 #03 0    -0LS 0\0 R 0\00 -0LS R000S p-L@`PT   @Tp -Lh6 -Lh6 -L% -l0LS) Q Q #Q R=?0PlPR=?0p pPR=?0 ! P -LPpW`u@P0UPH@T/  P& - ? $1Q 1Q 15 0<0Q` v$0`U 15 0<0Q ` $PH@ T 5 -L`PUpL@H0H@T  qP $00cS`H@T 5 -LM?!@% 0 <0Rp |1P[t!t1QQ h1QS`1^+ ^ L1^ I@1^* 41^ A(1^ = E!00A0>   0  0 3RK P NK L00KPi(!CgE#òͫ#h615(1<1L1 -<0 LR (  5h6 -Lp=?00 4A ^ T 1@0 0<0\ 0q ^ 41S 81S 1@0 0<0\ 4<0pqQ 418141S<1 h00h0 -L=?0!4@  0 <0R <840 01P 81P<441 S h00h0 0-LP5@P -?  !00C0!!000 ! QA50 0 -Lpw=?0 $a@(P X V 10 0 <0 Rz PX $1S (1S 10 0 <0 R P P $Qw,QzZ (Q$1S,1 h00h00 VX Y  1S $1S (1S 1011V$1SaV $1S1145 -=?0!L$aP q@(  0 <0R U XP (Q 1U (1U $QV,Q h00h00 VW X  1S $1S (1S 1011V$1SaV $1S1145 -P=?0L `$q@( 0<0Q"p 1P $1P (1P u 1U $1U (1Uv 1V $1V (1Vp 1P P u $1U h00h0$Q,Qv(a0 WZ X  1S $1S (1S 1011W$1SqW $1S1145 0-L @? P 000 3R 10^ 0  003S$10^  0  003S(100 -L?1@0 0<0^"p 01P 41P 81P q 01Q 41Q 81Qr 01R 41R 81Rp0q 41Q h00h04<r8! 0-L @? P 000 3R010^ 0  003S410^  0  003S8100 -L=?0 !,P $1P (1P P 10 0 <0 R ,,1 S h00h0X0 \,1S 101\ ,1S1!0 ! 45 -=?00!L<P  41P 81P P 1@0 0<0\ <<1S h00h0 -LP -?  0@03Q  ^ 07 0-L@P=?0lQQ0@4 ; #;@\ l0S\- =?0 R 0S x x0@Rh0 @D\0@SQ PL0HP Pp0Sx x0R HP@p07 5 -LP=?0p@4 ;4 #;! R l0SR p7 -L=?0p -LP=?0x@4 ;4 #;! R l0SR x7 -L` X0H ?R lp0 S H R00 H"l0t p0x0 5 0-LP0=?0@A TQ_ 0 0 3R \ 0 0-LP=?0!@@  0 <0R0 U0 0Q 0 3R \ @Q0 0 -=?0@!LR Q0S R -L=?0 5J5 -LP@=?0!& 0 <0R@Tp!^ !  ` 0 0 3RH P40``! !!+5K5 -L P-? vό 0@03Q  @T  -L P@M-? 1v?K0S10 0S10 0 0 3R \  p-LP UM6M?@ 0 K 0 3R`  ]^ "1v? R0S 14 0 <0 R U 0S0S 0K p p-L@`KPH`HMu# UD 2?2c`0 11!Bb!!"\ 1?2cX0 11A"aT 1@0 !< 180 M |2?2c`0 11!Bb!!"\ 1?2cX0 11A"aT 1@0 !< 180 +Q 0 2?2c`0 11!Bb!!0"\ 1?2cX0 11A"a1T @ 1 !0<0 8 =?0 H 03Q`K \ Qp -L 0S ? ` -L++=?0! ! -L@P< -"$-"`-"t-"-"-"-"-"@Q2=?0`/? 0   03^`00 =?0h Q=?0h Q  h =?0! Q=?0!Q  !  0-L@?P,P 0!@! #0$5(5 -L@KD1$MM?@D@  H0 xHK8PK#  V00!23΄p  Q03 0 00!ᨀPLp  L 000S 0S 0!@!T `  0@`R TgE#1(5$5 -L -0L( PR  \ ,0S S$ 0b0σ(0PS  P , R R$ 0b0 0`S00@@5 -L@0! <0 S 440<  <00 00 !<57 -LpwM.W   =?0 10PK  =0 ?0$0 <`<0@ 0 @(@ *I+0pcW70" -(0L0(0 -L=?0P PRdd`0\S 04S 0S,3刢  !(0cS 0 0 S0S 00 0"0C00<D0< 0<000B0pŸS P P<@( 0R  0S , R R0$ 00b0? SpP\L p00!UB !000,`VP@P0S ' 2P@ !000!P0S d "T ht⣾tQ,0SP0 !00C0 R  !R 8 (00(00S]00!HQ  0$ 00 bB1 0HQ00!v( 0PR  0S , R R0$ 00b0?pb61T5p7@@5<577 57u  !0S 0!@00!T `  0@`R T 0S$00cC10 0<0< 0 <` 7  11 -LPMb 0 R] 0 p R , 0!0 P U1 \0E P 0' ,0`S  Wp 40S40Spp7<5@0! <0 S 0<  <00 00!  UW @0! <0 S @80<  <00 00!0!7<5 -LPPV 0 RpQ D1 @R0!P- a0@ 0" Y  T @ 40S40S @0! <0 S0<  <0`0 00! PT 0! <0 S 440<  <00 00 !!p7<57 -LM=?00  @0!K0  0 00! 0 0! -LM=?00  @0!K0  0  00! 0 0!  -LM=?00  @0!K0  0 00! 0 0! -LM=?00  @0!K0  0  b00! 0 0!  -L -LP-? 15 0<0P)q'$0(Q0(0s0S0$0 -Lp@\0?SMs? 0$`K 0 3RP  ᅿ^_00!T D4$; #;Q l0S\F W(pW@$0cS<W  S00R40S 15 0 <0 R% $!$1R 1R 15 0 <07 R (p<$0P0 < 40 < 00000!<5 -Lv -L o -LP=?0 @4 ;8 #;! R l0S0S(07 -L ^0?SM(=?0P @4 ; #;!7 R l0S0 S 00 @K 0 0 3R \   -40 LR -? (0S0(0007 -L0P P0c00 -L0P P000 0-LPPM=M?@ @4 ;L #;! R l0S\ (0$00cC1 7 0111B"c#b1130  \  0K 0 3R p\ Q0 -L@#(M^0S 8#8SA(A$A"A!A R1A>=?0T8Q$234`KX32~l HPKS0S Al0d 0S l|,0Sld0S Tl H0S 8l41D5<1@1L1T1d1l1t11111d 0<Q(CT $@T1111 0-L@@NP@2!2!2!02!2!02!2!02! \00W0^0000 0-<L44@H@(0TP ,H@T011 5 -LM?@0x0p0$0##!000! 5 -L@0! <0 S 440<  <00 00 w!<57 -L0!0  0! -L0! 0 0 ! -L 0! 00! p-L  =?0lp  `<0S K?0@0 @\590PH R/ l ^ p0 S x0 S 0 0S0<0SK?090 ^0Sp0\0 Sx0\0 SH Rpğ7`5 5 p-@000L0 $ $(0000h`PU 00  00C0UPU P0bUpp77 -00LT@P  7 -L@ !00C0 R  !R 8 !00C0 R  !R  --? 0L  :0 0! !Y p-L1`TPP_ 00  00P !00000! @T R( !000! @P !00000!@T Rv !000!@0S P !00000! @T R<W !000!@ 00p71 -LP @1S  -LM=?0s, Wo  !000!e,0A "TPP\ 0 ; 0  00. @ T PH` VP<V@@A  ὸV P 0!   !\00fA  0S0fS0bA T1 ۹,0S    0T괠7 -LLMP L H 0KD @ T X \ PK`0 <@K d T ?0 0 l0S<0K0TPP,Ǡl ] /T2 d R* !000!!!000!#0Qz0S P  !000! 000T0S P  !000!T 00000h0!0h0 !T @:0T0T :l < T@ 9  S 0儀㈀ 0003>0(?00Pt d 001T 7l0  PTl #!000! `m1CRpPb 0H00P !00000! `V R$ !000! `P !00000!`V R !000!`0S! P !00000! `V R8 !000!`77771 00W``sT V"'l aT0  #!000!03hRP 00,)TP,Ǡl = ,P,`Vp T| !000!2 :R`P , P ,`P`,0!^ !AKP Slppppp4ptpxp|pp,0ph` WU 0 N1R@PQ 0:0`0004 P 0 !000!0  0!  B !$0S$0 $ $0(0$@$0(0, T(P,0S 0S h 0 0Z@ @h@  pW0Sc5, P0R,00! !AZ,`pP`777 pW{TX P`0\Pd pPT0\0d P3` !L3 ! 000 0 R 00l0d0 |000  !T |0|0  00 HL0L0L HPLPp00S0P0Pl B$"+"+0S0 00P000  !0  `p!000d lR0 0S <K!^ !AKdGa)  0S P  !00C0! 000T0S P  !00C0!T 000!!00C0!% !X20CX2X"R  !R  5777 -LL0@T< 4  000 QI5177 p-LP`-? d0@AS Ad0S  R ,0R p  pY" 0-`0L@PT 0U: 0UP 0@T0501 -LP0S 40 R R  R005 -H0LS P000S5 p-LP=?0` @VdPpV, 0S r0PP"  !00C0! 000p3 dPP`1U P  !00C0! 000p p-L@tm?`dP U d0SPp -LPd0M@`T Pp 0 008S 0ၽ@PTU:5`1t1 --@L Իj0 R b=?0l RZMu @7xPQ pL0"c1ADZ@Dt 00!0S Ch61p71 1ȟ77Tn8,10 -Lp MP b"b"^"`"`"b"(b"Tb"b"X0?SW ? 0 0 3R ^`,3< R80KP C4` 02 R0S"< 00 0<^@00!2 R^*`|R 0 A  !0@  !0ST:00!X0?SW =?0 03Q  WP1Y#00!!0UP!\p1@ T` * F9S:D0HPq@0  !0  !N@@T*!0  b0^*00!^N @T nJ*0 0@T:>00! 00!400!``0 00!)00!480 00!꜠75p66?655 50GS00 Wp00! p00!55 -L^  ?16 0<0\  --LM 0!0 @ X, \h*0 pS0<S0/S7S0>S <00l 000*p0T 00C0\"*DD`DPD@D Q00 00 l6,55p667?600000 R \:0 0`R0P @ Pg2 0S  (@TZ , 00\:00!!M,,5575 -L`pP0!H @T 2 0S  (@T!騠7 0-LP0!< @T 2 0S (@T!0騠7 -LP@"M0S2S02ű0S P2 02q0`S+ BqPQ0 RQ02ű R 0P 崀Vᲂ0202`V0q2S2f 0!" R0(0P(0(0(P2M 0` @0y'yVC*8K0 y@0D 'y R 00CTV-:00 80[<S7 [0/S7S 60[>S 00B5KD(57767p6X0T0 ,B Q 0D @ R0`V: !557 -L0!p @Q(0N0 (0  (0S S(0(00S 00 !騠7(5 0-LP@P l0S Ѷ0 l0 -L`=?0!@( 0 <0RJ \PP ` 0  0 3R*˲@P T*`p#@@\`V'H0X`3 :TP` .HPP HyH00 L@0  `0$ w\P `q\x5 -L@TM=?0!( 0 <0Rl .\PP t  0  0 3R*i@P T*t@ xP #@@:\t@ t0SEx`P= 0 0 3R\0<0@LS)pPKH@  0 0 3R m@T  d0JRH0 pR:t 0Ss R 0S:1Sg0S $ R:01 SY, R R:0RXN0 R R:0R0C4 8R R R:0Q*0a 20  ,0GS DQ Q:0Q 0f@l[PP 0 0  0 3R*㩱@P T*0|P #@@z[0St Rh|IP h |o 0H@C 0H 0 3R  ὲ@T ] =l00(@0$P)*QL X0X 0S S 0S8A1X1111(1T11111x505|1`(00 (  0 P:|[x[00, 0R@00 P Z0  !00C0!00@00 0{|ZpKH 㜯xZ @1 -LP 0L  !000!000  -LP=?0!@( 0 <0RUK Z`P P 0  0 3R*Ѱ@P T*Pp#@@ZPUcPZ^PW@PZUZ(0PSN0GSD0S P0SA000L9 p0@`T% (0PS 0S0GSD0S P 0S (0S0000!p@TW@T  0 00@TPx505 -L`0M, pP0?U !@ T* 0 0 3R  ᗰP`P d, P0 U,   0  003S,  Q  x505P\0U P0< U  0  003SQ 05 -L` M, \!Xs 0A 0 =?0 0003S0P ^0 p0?0 Z%*4 $04 Pᦳ, @T+0 0 0 3R P, `40 d, 040 0pW:0   0  003SpQ ! 050pW *0A$0 p @i0 W:0   0  003SQ  -LpH!PMg 0A 0 =?0 0003S0P R, -0 (P? 0 U 0`)@ T)0  0 0 3R ៯Pp d,0P0U,0 0   0  003S,  Q  05PU 00PU0   0  003SQ  -L M, 00 A 0 =?0 00003S0P l 4 ,4 ? 4 a V PD 0 0 3R" f pY)*媲@ T34 0 0 3R  P00P0 `R 4 d`, P0pY:40  0  003SQ ,0Y *Pk,0 `Y:40  0  003S`Q  p-L`P PM6 R#( 0$0 0 0 GRD0S ? 0 0 3R@(K ᱮ\ 05`M?@ 0   03Q00P p -L`p@PQ3 WPP  =?0 03Q*@\ T*#@@WP@;@ PPW1PWY )~" ~"8~"T~"p~"~"@" @ 0@ 0a@ 0@ 0S@@05 -L`@M1PpU  0PUVQ h@K@キPUH 0AB @@hP #0d0KcK; &)@K? 0@ 0 3R  \)0@`S! pW @*0h0 dK< 0)0K 0@ 0 3R  ҭ\ @`p0@W:PUx5 0-@0L@P@T 0P0x5 p-L@0P 00S 0000$`P*0 ( (0R 0 0RU (0S0 00 0P:0T00  0S  0ScBpx5 -Lp2@M`d2zZ ҰPW: `pevPeUW:  ᅬ`peh@K >PW: _`pe0 0GSD0S &PWx: G`pe0 Wm `L pG:*  W` ` pG-0WU ` pG"@ WJ `pGWA `pG(X/ W6 `pG0@RPW): `peX W 40  pGx50511111111 1W 40 pG W 0  pG ZP g$1(1 -Lp|MP, 0 U- 0A' %` @V! 0 R,   0  倳x5,1p xp Rp 0R@`VPU0j, pc00  W 0<1 -L0pPU) W ᦯P0A 0S @ `ᖯP  !000!000@D`TPUx5 -0L\ 0A 00# P0"03S 00P * !00C0!000\x5 0-L@=?0TPc !!00C0!r<0S `` >00!L!0Q0C00000H L0L0LH0H0 R00 R4 00  00!!1 01!1 011  0 1R 0 0 !X20CX2X"R  !R .0000(1F71 -xLp0H@Q x0Sp0S  l0S HQ x Rp0S 5 -Lxt0H\ \ p0S0S l0S p0S x x0RH\ 5 -L -LP !00C0 R  !R5 `p 00ApT  !0!!Q c`@ 0bV0V P   QS PD鴠7 -#LR 03 -L@ !00C0 R  !RG P  !000C000 R  !R . ˻P  !000C000 R  !R .x P P  !000C000 R  !R . 0FDH17 0-CLTV PS !00C0 R  !RG 偻P  !000C000 R  !R . kP  !000C000 R  !R .x P S P  !000C000 R  !R . 0C0H17 -L=?0, ,  !000! 0-L=?0PP@,@T UP@ tt⛩ !00C0 R  !R 0 0-P,@LT !000!vP0T M <0,0H01 -L]?P0`pCW2pB2H@T 0S 0\0p`P3P0P3  H@ T@pp0S x x0RFP pH R p0S0SP p yp u\0S L#P3RP3S 1 0 0 <0 R0\000!\0S@ @00ppp000S0@0@ R\}pPp0U$ x x0R 00!P  H R p0S0SQ   00!0S00! R tJ5 5 -Lp2] ?PR l0SS000 Z,@T !000!P0T MX T0,0`P 03CTV `c !00C0 R  !RG P  !000C000 R  !R . "ѹP  !000C000 R  !R .< P P  !000C000 R  !R . 0LB2HK8K8K 00@T Zl0 Sp p0z p 0jR\00S0XS S  0S* SX0S 0 W  PP0V0U0S 0   03QX0400PUXPlPv 0 00 0 00W  P00,P0V0U0S 0   03QX00PUJ 0lPR+ 00!H L0L0LH0H0 R00 R 0000HL0L0L H@L@00 0S0@0@00!@TR0C QH\ P0\ES#9gE# 5 P8K009 -L0 -<0L Q',$0 (\Y -00L   11@"`Q 0-LPP P P -? 0@S `0 bP =?0@=?0@007 p-L P@QM (`KPP=?0  03Q \ Pp -L@ Q q 000F7 -LP@`opl@V P-U U $U !]?P`@Tp th0A ppT@@=?0@p T@@=?0@p7 0-LP@Q M =?0 03Q$K  k^ "$K$K4PKT  T00P0S=?0  03Q h\ 0 0-LPT@K@@Mɥ  !d1d!2T0 TT 0"L 2P0 0 2H0  B"K00!R3WD0 4 ?0(*S&:( 0#*S!: R0 S 0 D0@ 1D0 !@ <08 1<0 !8 400 140 !0 (0$ 1(0 !$ 0@ 0 3RTK \ 7Q 770 - 0L7 - 0L逭5 -LH0P =?0 0003S^  7 -L=?0!$ 0 <0R 0 0 3 R ^00!H H0HP@ 8 0@00  ! 7Ƞ7\5l5p5 p-LP@PM `Kᠭ=?0  03Q }\ U =?0  03Q i\ ꐠ7p 0--? 1L4 0<0\0Q h h000S P00 00!80 2c! 00!P r0鄭577 p-LP`PM -? 0 K 03Q \U(@K =?0  03Q \ V KUp -@0LS -? 14 0<0Q l3R  X3 T0S  ,0##D1 "&81"AWT  1=S !c"b! a2a48A\  R7 04=?0, Z  ؿW  < ,ߕ<տ0 <!< ,Е<ƿ  0PR5(7< P1 -L`PMp P U: Q 0S`J$JJdT@ @0 00WPpW  -LpM,@T !000!# `!^ !A)K+PP 0 0 0P! !* -LP`M&=?0 03Q \ P`dV pK 00V010#@PZ  -LPp`SM'ڀV@1@#=?0 03QK ῗ\   K000mPXPp``V 0-xPx@Ltp000   000  ?P,!000P0666 6$6 -L0! R( 00cS 0 S*2 S*5x s8h ~?0ST 0L !=10  ! !$i$6$6 666 661 -L0! RP 00 00cS 0 S*2t S*5d s8T ~?0S@ 08 !=10  !$6$6 666 66 -L0! RP 00 000 ! 0-d0LS 0!@00!T P  0@PR T0L5 0-d0LS 0!@00!T P  0@PR T0P5 -t2t LhB R ( 0@00D2 R9"""P"X"00/ . 0+1 ?B8c02c2cQ  00C1 ?B8c02c2cQ  00000000XP0`0$ 0<0 0Z0 a0C000Q a2B10c02A100d5l5\5X57E.1H17`57555t5П7 0-0L Q 00Q0cQ00 0b00@P 0 00q0aC;  c 0QA; A  0鬠7Ƞ7H5D5777 0-L@@P@DT ,0R0=9C =C0  07?B p-LP1`000 <1BT11\ p1T  i@T @T @_@@T @T @T@pQ -LPp`% 0M?@l0S 00CS 0 p00$0Sl 000T 000 000, 0S0S 0007p7 -D @0LH R 0S 0  H R 5 -L00!"Ÿ0@S 00E00!"0dP}?0|B2b1b!b1115 #ll02005#a!000! 0 0bSt0SH`!@0p10 P/ QE0000cS01 S*2x!S*5h!s8X!~?0S018!!=1 00  P00?00 0S`V 1 0R  Q 00000  ! 00!0H000 0 0bS 00!7ԟ75 7$6 61$6 6666 0-0  @L@HP  !0  @000!d0 R 3PP  !(0(  P000!0707@5p7L5 -L0 M0 K0 , K 0 B$0 P -L=?0| -=?0 Ll -L=?0  -L=?0$ -L=?00 -L=?04 -L@PM? 0$K 0 3Rp ` ΐ@T Z t0P$0S@PP0P (0S 80B`E@0T ɚ;MbG& 0 /A b11T0S 00P U x0 111@"c#b1130$ 0 0 3R ᆒ\ k_kQ -LP  !00C0 R  !R 0 S 0 0 ,(6 -LP%4%0 1p R 0 S0!  !`P'@+PP0H` R 0 S0!  !`\ + R 00p`,6(6 -L!(0"(QR I -L!(0"(QR I -L!(0"(QR I -L 0!PQ! -L a -L 0!PQ -L  -L !( 0"(PQR A p-L `P=?0 @03^  1S:0>!$0` V+ 0  0 3R $1S:0I?!$0 ^ 0  0 3R (1S:$0J?!$0 p5 -L !( 0"(PQR ~ p-L `P=?0 @03^ 01S:0>!$0` V+ 0  0 3R 41S:0M?!$0 ^ 0  0 3R 81S:$0N?!$0 p5 -L  -L  p-LPP@M=?0`@A TQXKQφ 10Q0 0 0 3RXK ː\ p 0-L@@M=?0!P@  0 <0R T 0 0 3RTK ႑\  PQυTK0 !P@A0 - ? 1LS:0>5 - ?$1LS:0I?5 - ?01LS:0>5 - ?41LS:0M?5 - 0L⧳餸5 - `L␀apB1 PR  dS㿯 O@ K 0@00pW ` Z7|1 -L M, p0 (00 S0040 'ʠ 0 B 0C R  ㇯ 㶸6#z00zWw*0SQ@T 00  J00C0T ~ D㕸P_ '0 ?0;`/ +@TA @91= 1c2c>#"&1"Q1=S !c"b!a2a48A\ࠓࠃ^ 04 R  Z@, 0 @@ !000!I00zW*`u|17R5(  -LP M4  0 , U %:A:``4 廮`DF0 H 0e0S6#80 0<0 VDP 80 pdR\ ͮ P$%/46 6cR'v#vW@ = @pGT4 P+ P1= 1c2c>#H"&D1"1=S !c"b!a2a48A\PPU 0 090K;0@@ W@ )JJ<0 `80T<0 :4 H@0 D04 #ZZU0#03U  Rr,d04S, 0ad0|1q+R5(,0d  -L=?0,  !:r1 0 !5?   1= 1c2c$>0  R5( -L`MP8 p,0 Q< M?@,  0>"0P0e00 !,ǬP4 0!^ !APK *4 "* #"&1"1=S !c"b!a2a48A\@@T 0 7 |1771R5(8j00S V:D< ZZU0#03UPpPU 6#0  80 YY0 V:@, P0R48 -L,MM?@,8 P * 00  < j, 4  p8< QL@ : ᥫ40 PS pT,V< 0j0S6#D0 e@ %6 RDb@T 00  叴00C0TðDڴ  U?0;P P @ @Dd㠑pTp fq 0e0S6#H0 VPP P徴1= 1c2c1>#"&"1=S !c"b!a2a48A\P 0 0 ᖴU5 . 1= 1c2c1>#"&"1=S !c"b!a2a48A\\ 0 6 |17R5(<17@jH00S V:PTpD !ZZU0#03UPIPU 6#40 <0Z Z40 +:L, P0R8< -LpܢM@b͠ll>@., 00 Q͠\ !l"b!xa2a48A\Y 0S9 SO 0`J "PE0@0@ <80@S 0D@@T@@T (, ,0R& ##5(, ,0R #M ?@,0R  0㹳 P0R?q: =`P? 0 0S-0 ,@d00d00 U<H<<Ĉ<M ?@,0R  ߲<00び P0R9`4R5(<7  1 p-L@$: 1P\R ` @@ Ip/ +$5?P@ =?0, Q  ▲1= 1c2c>#"&1"a1=S !c"b!a2a48A\ࠓࠃ^ 0 J$JZd0 S8K㥩U< ṉ<gp|1R5(1 -L00`pd S:]?P,0V E P0V(ᛲ$'v cR *F bv:#:S l>0N@]?P,0V  P0Vu$Z -L4M0p X, /40W+, ,0P0S 0*0@#&ZP  , P  40|0S2 ,0S/ +=?0p 0@8 `PT 40U uXW jp40|0S ,0S  -L@(KMb;P`U0$q\\0\ 0S:0PS"@(00(0 50PS\5x57(A4P 2(P5(0U0(0  -L`Pk4@P4@P<\0 <奱d00d00< p 50`S' 0P0P :80@S 0EPPUPPU3(, ,0R #< 0pp ۆ(, ,0R # ᳱ -LPpS<` @ :PP<H<0d  d <0@ጱ7 -LP`M,pQ \ 0(0   @P td00d0<忰0 << 0W0S0 K -L`M0 p,0 ': 1_  '6R Q@T 00  ˰00C0T D  ᐫ?0; ^4 \ ,0 z0 '  ,00 ,0S   00 7=?0P Q✰0 0 -L@=?0,px`0TPP:@@ Y 0tPJT:|1 0-P0L PR <0< @0@1,0 @@T00<7557 -L]?P,@0!^ !AK< X/:0L p0`V% X aoP !r@00cS0PZ 0U00S Pf%P JPL0L! !р -LM0 -,0 ? < `P,p 0S 0S>0ZZH1jXE *680 r@*0SJp0  <l0"6S)V, 0 S S$ ,,  1 0  1 0 @ 2?0:: S+P 1  :#:S  P DBj PP  00,0V < p  080!p00040  0  1(0040 p   0000 ,  @4 < 0Pw<h0 "6Sq0 0S 8Pg V 0  Qq@P^ 0 4` !000!0@P*40S zE@PE,0Q 0 !000!h08  0h0 l0 0l0h7500S 0 !000!040~C<,0W 0  C<P0WӮ  7 0-L@PU0=?0T T, !N@eQ:P  0S0@  -LpQZ`8P QQP@A0S 0\S 1S P 010150 0   Q*0S 0\S 1S Q 0101 00 AU00!0S 1pGW 0-M L K0@\ 0\2 " 0@\0S@ 0@D0 0PS  0@S00  0 000d0 -LP* \ 0S0S!0S \ 0S \ 0S 0 R 0S0S\  p-L`P; 0S   P 0S p@ 0P  R 0S@0 PST 0S P P 0SU 0S0S "Pp00p1 p-L^P~@Pp`V0 ,  ? l0"0lSh0 "0R* 0000n00h  h 0  l00l00S p0  p -LP#Fhpdh`  l00dl00 VQ,0S 0S 4P A1bQ`4 V00 f"600, @ 00  0p8p0, , 00 0c#&0 44<0P<0 !000!,0S 0S `7 0-L@$#C?&BQP Q 0S0R ! P 0S \1: R !0S."*R a0 -L@M0 p:#:Q  S``V1aT>0N@T0, KPP 0 0R<0 *00R*0< S0S@iP4  7,0 S `` U 0<S* 00 0S $PU 0< S:PY00n 08 0`< V`1,0X! Sf 0 S  0  0V0X 4Q8  0 !00C0!4 R 0   0!  !$ R(0(0( $0000C0M?@,0W 㱫 P0W 4 084 Q 0 !000!PY4 R $0$0 ,<07 0-LP=?0, @!^ !A7K! !D0 -LN@T]?P,`E p0  l0 "6S< pP h0 "6S 0S$ ,P 0uPP @p@p w@@0,p0p4p(0@BP@W 0S7: -LT !000! R 040804S B 51 -L 00C0004 R 0S4 40 4$ !00C0!005 -@0Lh ᐠ1 -阀pLW' @Pp`P0S ~(, ,0R #Y~(, ,0R #r* -Lzq_`'zP`%&:M, ,0 Rj P ` V*W` 0 S]@ЀP  !000!0E B0!   !W 0 SJg0 SK T< ,<ڨ80S (E p80S  EP m~~Z*x~(, ,0R #b)l1,0R -M8@L@ 00S00   KD0( R 7 p-L8P`@0 E>0(@ 0S`Tp -Lp`PU( @80PS 0 S* S: !000!80S p~(, ,0R #P) -L`P@ 0p0 <5#5# p-LP@0` [ !000!0 `0S0 0S  R \E0S_` =0T PP@@0$01<0CNp1n1,7$7 -L@P0`0%"02 00C q a 0000 !000!0 `0S0 0S  R \\0S_< 0@(@P,7$711 -LP`p@@T 0S 0Su#  0"!C3R !P0#P $T10 a ᬞ0000 !000!0 p0S00S \` ᔞ0S_@ ጞ0PHP`+87711 -Lt0M, 1 0JST XR*0< 000p0C'"2  !`@7$7,7@T 0S 0S" 0"!C3R !P"P $PT0PP   0R`P 0@6(P 0JS ,0X:877 -LP,K1M}?p0p  40 }(4@KQ0S 0S 0S 00 ( 0S 0!@00!T `  0@`R T#0 00:gE#85 -LP(K0M}?p,p  00 }(0@K0S 0S 0S 000 h0S 0!@00!T `  0@`R TؼgE#85~0P(0 -L@ ~P  -L@@T 0S 0S"`` 0"!C3R !P!P #T !000!877 -Lp`@@T 0S 0S! 0"!C3R !P!P "T !000!PU {(, ,0R #〽'877 -0L PQ`2 80UpEp*0&"02 00C A@T 0S 0S)!\\ 0"!C3R !PE!P "T PEU*$7,7877 -LM, 4&J0@  84  !#<!R001@0 08 0 404 S Q*800 S**40 Y,0580 58080 4 \48 000, R ,QY 40 S4 0 S :00I8Y2\8  8 , 4 < < 80RP*0 < ZJ*0< 000p0C'"2  !P@7$7,7@T 0S 0 S pp 0"!C3R !P P !`T.`P   0EPP 0@)&P<Q2 , `R0S 0!@00!T P  0@PR T4000<0, 804080@ , R,487785 -LM, 0 4 < 80 8p ##<!R00!0: @0 ,0@0 )P800S*,04,D 8 D @04S 0 S@ ,, 4 0 0+0,#6, 0R,05DQ , ,0S0,0,,0 S,2@0i'"2!010C` !P@@T 0S 0@ S Ÿ 0"!C3R !PP &!Tw  !000!0! D,< 00S <C4 80 @) )@ D%X 40SD,< 0d0`PU y(, ,0R #㋻#%0 y(, ,0R #z, 00P0D,< 010 004  0$v7$7,7877Z$ -P: @@T 0S 0@ Sw 0"!C3R !P2P T`0 @ a 㮚0000 !000!@ 00S0 0S  R `\㓚0S_@ ㋚0 p *~87711<4!:@ R<40( X@ !J6  00Z,0(0 m$<剖 p-P`L<S@1@! zP @` 0 00d0 0 00p 0-L @PM? 0  003S@^ $@   0$ K@ D$@0T@\K#0 -L? @ `pPS 1 ! 3 0 3?< 0 =?0 @ # T   #/Q 0 a 00 -L`p M7P 1 0 `F\ 0 Q 0 `S 0 @ 2?0:: S0  `参``Ve`7P` 1[ 0 `FSW 0ST 0QP 0 `S 0 @ 2?0:: S0 `a``V5Y3 @PK0 ` W  =?0 03Q ^ 0O8 4 0 `08 K, 8`,0V`W =?0 0 3R@007 7TL# -`40L8 h!#<Q080DS0 20C320008080Q?00 @P"6UP!T6p 0BT T1*4 P0S 0!@00!T P  0@PR T0080\0 VVEa0'800807785 -M40L, 0 c0 ! 4 0 _`40 !:<0 X:=?0, Q 340#"2!010C !8 48 8@P! 0`u 0  < U, R ^+PP <<-w<[P"<R<0X*0 < E0 p"0'"2!10C 1!`@@T 0S 0S 0"!C3R !PP PT+PP   0f`P 0@J"P pWPU 0 '4  0P0 0nPU v(, ,0R #~"30 v(, ,0RP #mM$7,7877sv4  0P0 05! -L0 S 0  -L0 @C -LPpHM8 , %00 A 4 -? ,0\ \40, ab4 U:||8 噗`%::D<0 F4 D 0e0S6#@0 VTP 0X0 <@0RdH Fd@ `h`  Fd@ 0h0 増Ѡ ?0;$%/$0H S6#L0 P Fd@ `h`  0H ` ` H0@RP6 0 㰠0S 1= 1c2c>#"&"a 0A0< \,0R  \ P0RJ 0@ !000!7T] \ ,0R  ̟ @p \P0R'#@#00 "S  R1= 1c2c>#0"&"A  '0 0`#R t0|R4 PPu(, ,0R #: 1i)R5(1P00L SXP V: D0dh`0!J@ JD0 TT:8T X@"Z40Z8 UU:\ P0R4 ,0c᫟8 -L0 0-P@0L (0(S0 Q0PP0S 2: S 00 Q Ꮢ,P055 0-L@4PP4 ,0S1 \.  a0 P&$ 4@T! 0S ,PU 0T0!^ !AK  0T0! !Ѿ00 -LP@p?, !^ !AK:#:S,>0N@`&*0$pV! @ pT 0U1P1 V U* 0pP  p0pPP @,00! !j -Lp0P`@P 0Vp90 V9800804 !000!,0S 0S = ?0,p00 b"6007 -L`0Pp|@P `00 0c#&0 0W90 W9800804 !000!,0S 0S =?0,`y7 -L`A6PP /pP 00 0c#&0 080804 !000!,0S 0S ,000 Y 0c#&0  Y980M?@,P8P,7 -L\ @0Q0R 0\90 \980080 0R $ 0e -LM, 4Q8 80 0o40140 0`0 #!6J0,?0@ Q`` v/, 4 0d ,0h 4R01@8!, 010C311,0 ,00XX1d*80 P 0Z, 00XX1U*80 p0 0P0C%"2  !@@T 0S 0S{ 0"!C3R !PP `T!&`P   05P8 0@ 7$7,7877 Yl 0S 0!P0L@00!T P  0@PR T 85 -LP`0p M ?@,0R ボ f P0R؜ -LS f#f#f#f# f# -LP@?,p !^ !AK:#: S*>0N@`V#: ! @ T 0U1P1 V U* 0P  0PP @,00! ! 0-40 0LP0,"2 00C A@T 0 S 0S~\\ 0"!C3R !PP T 0PP0,7$7877 -LP M4 `, RB 0,0 00@ c" U0c 0c#VP0 / , )j0X,0 $p@ XP1Z#Tm?`  0@T 0 0 3R0 ys\HzX0, -LP@pM?, !^ !A5K:#:S, ->0N@`V&:$ @ T 0U1P1 V U* 0sP  0kP @0e#vP, ,00! ! -Lp`("0x2!10C Q @PV%`P @ @ 0iP`  PPL@V Ft-0`*PU p(, ,0R #㗲/0p p(, ,0R #ㆲ  PP@$7,7 -L$PK0`M$0 p0'"02 00C  @P0S$P  @0P$P ,7$7 -L0M4 0 8   @ @ , <0 ?D T0a!^ !A5K<PX X0TPUT 00HP   @40Pv 0@TSX80S@ RQX `g8` 8L Q @ 2"0SQ X1 0 <0L R@ 202@弈2@0 @D@岈*'&:Zj8 L ,`KD0UP!#"0d2 00C !P DP  @P0S#P D@ P0CPTW 0T  0 D` 0 PL -< X4 0  0 3R r<L LPE0D0 0PPL H8p4 H `8 4 T(, ,0R #E L0S8^t,<P HPL 0SP@T0! !L L  +o7$7,71  -PMM?@,L0P  %:, a M0 P8@ :Ql バ 0eX#V4P 0<0 a 6@0 R'  㝐̙1/ +!5?`DFpWv#P  ,0ộ`J00ST:@ ` QQ:4<`!ZZU U:80, P0R0 V -L`PMU 0,"Y01,0 ;0ZP,00P1 @Pl P0804,0P0 !000!,0S 0S = ?0,00 b"60050Z51 @P5 00 0c#&0 P0804,0P0 !000!,0S 0S =?0,P[D@ pP PS P P Iꬸ5700 0c#&0 080804P !000!,0S 0S ,0 PP8PM,0?@,000 b"600,U ,   -Lp`:#:S >0*X p3  p.M?@,0!^ !AK/ pP 0ST 0S p000#"PU*  @pP , ,00! !э -L`Y0Z70XPD3@Ph 4080P !000!,0S 0S = ?0,00 b"60030X3p2@P3 00 0c#&0 4080P !000!,0S 0S =?0,PYAlPP PQepP PG00 0c#&0 080804P !000!,0S 0S ,0 M?@00P, b8P"600N,KU 0j#F  @d  l00dl07 -LR -? 19 0<0P>0pW*M?@,P 0S   `T 0S ` 0ZP:*0U*  @`P , W -L`P ?,@ p0!^ !A&K 000P`l @%,QX0 Q p,00! !87 0-LM?@,0 0!^ !AKLPL0  [,00! !0 -Lp=?0!P) 0 <0R,0 *p ,@` @T  ʌ: 0=`P ,! 0-L-? ,P0!^ !AKP@ 0 2h P#QD0 QP,00! !ѕ087 -M?@,0L0!^ !AjK,00! !u -LP` :1 p@\  %4 ?0; %/QX: @': 1`' '6pPP@T 00  壕00C0Tב@DA h?0;A`PV T@PݕL27 -L`@Pp-? ,0U V JD P TP0Un,0U  kJT: hP0US -Lp @ M, 00 `:#:S. >0 p,  4  :#:S W1gZZ0S V, 0 S=?0 , \,0?0` S :, gR00`0#Z00S 0 ,PP 0S0, 0fR W,0 ,c l0 0 "6Sh0 0 "6S 0S )mP 0, 0fR%00# V00S R 1R00fS:)Ơ,0h h   ,0, l0 0l00` c 0 _ 40SPW D/ +!5?`TVX#@6ZT0 , p1= 1c2c>#"&1"1=S !c"b!a2a48A\ppW 0I52R5(HBU:4  P" Q:008P, #JJTT:2 0-L@PP t t05ˠˠ 0:#d\0 Q  0S* :0 077 -LP :#:S XP @T 0S 00? @T 2782 -LN@M, T0  1 $R* !P 14 ** @8@ !< 媒< RY d8 f0jY#&6 pRHQ@T 00  00C0TcD!K  ֍ ?0;P' PDF 0fpWv#0S w,0P <J00P+T: R 6#jj V:0S 0 0872I572< 6 < #8  Z0#03Z@@T0S4 ; -Lq01a"@^  0 :CQ*Q*0\ LQ0:00* b\ L0 R0 ^d7 -LM , * 00 8 4 4 Rp 0Wd8 f40jY#&6 pRxQ@T 00  D00C0T᧎D!㏒   ?0;P PDF 0fpWv#0S 廴,0P <J00PoT: R6#jj V:0S4 6 4 #8  Z0#03Z@@TI572  p-LʠP@`P@ 0 S 00 SP@p# c00 0 cp -L`@0䠟S 0@T * @ 0\2    0@T: 0RPE 0pGu1= 1c2c1>#"&"A gD@PEu0 0R5( -Lp`PM0  lP1 RW00W0S  R00Q0SZ M* h GdAHPP dXh <<p0 p  8 W`! ,K040 " 0W:00C hpP  0 P@0A0 0 \*:, <S*000@40 0 0TQ@T80垳MPbp72u522,6<52170@ ,0S:h0d,0 0J h (, &v0$S8` ` 0 0 pPPP 0<0H@ {k !^ !A6{K0\`@pT 0Dk PX㝇@T0`\0p`! !.{06D52 -L@ !^ !A{K\0Q \0 Q Q@! !{06D5 -L@00!4 R  0 S@00!   !40SQ 0S P00! -L@P <0 RP p72 -L@P @1 R40S   q!^ !AzK 0S\0\0C0\P \0 0! !ыz`P>ᇲ!^ !A^zKX0 P\ 0P! !gzp7206L55D2D5 -LP:0S`  㮆 2 pR W | ᝆW0!,@$ 0,0S0#,0%(804 080 4 ! Pw 0 0pP 0p1700@00@0 0WD  1=Q 1c2c>#1"&"A`pD@fPU0@T*P < 0\2      P0@T:!000!4  B4 p`p0SpD! 0RPEu1= 1c2c>#p0"&"A dD@PEu10!4  B4 !2<p7GR5( p-L@P`0!^ 0 001 r  00!p! Pp p- L0`S$ 0P@@P0!^ 0 001 r  00!p!Pp 0S 㨅p@52 p-LP` !1= 1c2c>#"& 0"1@ bs 1  0AR Q @ R 00  @@ 0 0@P@0S00!pR5( p-LPA ` !1= 1c2c>#"&0"!P @  `s 1  0AR Q @ R 00  @@ 0 0@P@0S00!pR5( -4 0L 0S P @5 -L 2!^ !AzxK\0\0C0U@"!^ !ASyxK 0S P`1@q0 .  !40S%80 080 < R 0S .Q 10"!^ 10"!R@ ` V00!\0PU\C 0PT4 00!P10"aU&*40S#Q 0S  0 S@00! 00!PU *40SQ 0S 00!! ! w06L5 -L`pM, k@T`d@0fSQ0!^ !AwK ̐\PB00! \ R 0S R 0    0T2H 00k@ k@00!T`d@x206D5220fS\ R4 ! !ђw, 0006 p-LP@`00ecP0 Pp -L -@$0LS$00@S$0@0$0 -$0L0$0 -$0L0S$0 -@$0LSM$00@S$0@0$0 -$0L0S$0 -LPp8 0$0R@@b@ P8 R 0#4S RPC@ 0 0a"`0@0C00  ` RZ0@@0  M RpG}c\!\0`0 0`00@ 0000SC A?@ 0 0a `0@0C00   R0@@0 \  RD 2c@ ` 00 `@ 00 047h2 7D7 -LL -LP0`5 @ 0 0\a!00C0@00C00p@0  㿂 Rp㹂0@@0 < 㬂 R7$30> @ 0  0#a@ 00C 00p@0  ㊂ R㄂0@@0 h w RPqb< <0p0 0p00$0S0$0D7h2747 -Lr 0-L@0P K0@0  ?0P@0 Al 2 RTA,bbH 00 00$ 0R000h2747 0-L@0P@ 0 0`!0@0C00 ||  RJ``F! 0 0l`4!00C0@00C00@0  Ё R&ʁ"0 0  0G`@ 00C 00@0 ht 㯁 RLX婁PP0@0 $ 㙁047h2D7p2 -@0L 冁ph2' - 0LC3C07 -LpM,  @1= 1c2c>#P"&L1"Q1=S !c"b!a2a48A\@@T  0, x0S0Cx00@@0 㢊0S Tk$P aP0 40 半0080 # @ ჊m?` _(, ,0R #ㆡ, d00Cd0 P0R+ 40 =?0, `Q  ⮉0 @\1\ @@ 0!B#Q00^u=?0, `Q  ⌉,0S: 0S00 6 4@T !000!, d00Cd0 P0R׉00`8 ,_(, ,0R #T SV* 8 =R5(877 @P' U ^ ,  d00Cd0 P0R✉ A} 4 Ή^ 4 lj ^(, ,0R #̠ -LM, @ p00 l ,$:140 T8 :pp 8`&4":8:< SQ R/  S ら%< 2:&%/P6#::Y 1!,J|@00 00P xP P\0#03\PP x0S 6#jjV V:PxP <4 !JJ8 4 T0#03TP -L`|Pp@P 0UP1P 0qP x0S @T0|0x0 -L0 M00 , p!02S`V`Vm@ P4 HP0 111,0#Q00S!d\ 4 W0"0S 0 $D0 0 cR4 PR2Sx00x0x0 S@lH0PT4U0.0S+  4  !000!,P !00C0 R  !R zU   ۑ000 7 57`VZ0 - L$@ 04D0`D Ъ 0 0@ 00C 0_P $0S80SB0S?P 0@ 0]@ 00C 00p@0 dd ~ RHH~0@0   ~ R~_!0P0 0P00bPp^_PB @ 0  0H]@ 00C 00P@0 H ~ R0~0@0  ~ R~^ 0P0 0P00@ 0000,PU'  00C 0\(, ,0R #$@ 0T Jz7`= 7H 2< 2747 7D7p 2 0  0\@ 00C 00@0 xx <~ R\\6~\(, ,0R #㥞0$0Q ϩ000< 2 2 -LM, @ < 0 8 #3P0U40  AS4 ڈᄣ`E0UE p妩  00C0@ 00C0u^P$0S 8 R0SRE 0#4SAP 0@ 0\\00C0@ 00C00p@0  } Rpp}0@0 DH } R(,}]0"P00P00@+^pP 0 PP80S @ D 0 0\00C0@ 00C00P@0 <H l} R ,f} !000!< 0R00 , R 00S <0A< S(P+0@0 p 9} RTd3}i]0P00P00@ 000_ 7D77 2< 2]^47}0S  !00C0!80 D 080 D0S0@0  | Rpp|)]0\"P00P00"0@0  | R|  ]@ P 00 P8@ 08 0 0H[(, ,0R #2D R (P 0SY 0V@ 0 0)[00C0@ 00C00P@0  | R|0@0  {| Rxu| \@ P 00 P@ 00 0Z(, ,0R #֜80080 P5< 247@ 0 0Z00C0@ 00C00P@0 HH 6| R,,0|0@0  $| R|T\0 P00P00Z(, ,0R #ぜP U 40AS4 @ 0R0!0S mP  0 8,0Q0,0 $0 !< '< 24778 -L81 R``F PD@T@ pPD0TD@ q  00C0)D\P $0S 80S0 SS00S0@ 0 @@Y0`FS@T 477 2 p-0L`@0 P0@"!C3R !Tdp@0S  0R*0PPlPn@TZ$0`Vp(7877P5D -LPPP@ 0"!C3R@@@`$0 @`@bTP5877D7 -LpP@@U 1 A!l1l!h10PX!!S5Q!di?0`S `W`@DT8P BPnt`@DT"P`@DT 'PP NP VPEU@DTP T757875 -Lp`/P @xP"0@Sp PWP nltippD7 -\\LXq0T PaM?@#x0p0UY2.00 3$!0@;0)PP 0Q 00bdsZ00 ٚ0S 0!@00!T P  0@PR TP P8d㡛 P 257585755 p-L`0Kh0 M]?P4P  80 ZL@8K(@K U! V  0S @#㈚gE#7500<`W40S @#xNj00ꐺ55p -L M?@0;0(0;0 -L0㸀 pM?@#x0p0X2.0 ;0P01aA `R  0R*PQ0PU( 25(7D -L8M\0 K@X T Phh!h R0\0 XPX88!,0!000PKJ KT0K $[R P0HKH0 TPE 0` p HKP0 bRP u@TA p ` VT:K\0S YP !000!X $[0u#\P  \5x577|20 "0Sڤ2 -L@p0P `r y0th y \0R vH y 0^PW(, ,0R #w25 -L͠ll>#"&"@`Ap A P x0 | x0S ` xP0 00 POW(, ,0R #900R5(25 -LP@M0p80S R x0S T x1-R01b2c  b2b48"B\QVh x0 XL ~x0 Z0 wx0  \ px0 ^ ix0@ ` bx0 b [x0 d Tx0 $ @@00 B02 i2b48"Ba  o@ ;x 6"01(0, 0 !00 00j0?2R5((70j0&2Q2@ qT@  b2b48"B!R:00R: x@0T0  b2b48"B!R:00R: w ,加0,  `0 z 0X:|` w,ZXP21   0 !0S0C0(727 -L M, p01(00!0 @ T @0WX2  b2b48"B!R:00R: 4 w4 P0  ` 00  b2b48@"BAd4S, 0Z1C0&@0W1  b2b48"B!R:00R:H kw 06JP娀0`4@PS2,QZ@0W0  b2b48"B!R:00R: Dw0!  @0W0  b2b48"B!R:00R:D *w0 @0  w(72 \Z0! -L`P@pT( RwU U     0S W 00R*PP@T2 -Lp"M0`Q, 00 =?0    , rL0 C3"!R !P.P (P B$@T1 T:"P Rv 0R:@P 0R*0S @!@T,0 n@Pv,0 f@PnC0 =?0@(  ( 底,0 S@P=?0 00  ,V Z P70S bPB 0S  P@T0S Z ?0V00 P 787D7P52U5 Rtt!v,0S P 0"S*00  EP@Tᱡ2,2 -LP < -LP <@V -L !00C0 R  !R  0-LPP% @1= 1c2c>#x"&t1"1=S !c"b!a2a48A\@@T 0R5( -H0LQ 4 ρ Q*0 R:Q(7D -H0LQ 4 ρ Q* 0 R:Q(7D -L@\0\\X0 @ @B# 1S00T* 1S@@0@D7P578747 -LM@ P000  0 0001dQ` R p0!ሠ01(0 0@R Rl  ,  \!0Ỡ@T\22P5D74722 - 0L(7 -000L,,M $0 0嗠p27H7 7,7 p-0L @ `0P l8t gUP :H t0S <, t0 000Vp,725 p- L0@00P ` G` t 0P 0I0 t "SpH752 -@0L 8gtP 2 -L@R(,0,@S # 0-@P0L' TP"000P g80@S 0EPPU00SR(, ,0R #㰔H0 -88!L4p0 001("02,<0C !@P 0P` R(, ,0R #ご0 S 000R(, ,0R #lP嚟uR(, ,0R #_,775$7 72 -L`PpP* `P#P 1= 1c2cp>#h0"&"A`P 8 R5( -L0M,0 00 <2 xW0@T$"0S| ` d! 00S_$0S 0 S P  0 R2 Q<$0 0S<P*P0 RQ: P0 Q0P0P0@00 p A$00C$0P R 41,0  dAT(0!dS 00@004@S T(0T!dS 000 @T, $ ᵞ57P77x72 -L!x`PG 1&!@T0*1d1 , 00^+* P0S( `0( (1cP@ 0@QQ:0g(0 0^50^d 000TlLiDf<b0 ]7P75742h2222 -LMPp, U0 :K r`D0F0eZ# T: rV8P 4  d 6<0 RM  r{D/ +$5?PDF`Vf#\/  1= 1c2c>#4"&00"1S{2R5(,\<0{,? !000! d00d0PJ00ST:< `"JJT T:8040#ZZUU: -Lp`PP @T  0!0e @T -LM, D!1`00PQ*$ 0pS S P:CS004,a PP 4@0H@T , H@ Tc0 P0 R <0#R 4d,0  P7 527 -LM-? 1P 0<0Q D@K A`P1P#1`1P pD 2: S 3R !l40P 1`1 P R R D0R`Pe\400 4 1l!0P00A, 00b0ppC`P8 pQ!a((1P 4@1lQ1a!P\4  g1317! b! l4 g1317! b!!0, 00 5P7770S D0 . Z< 0D0 `0@0 ```` M< -LM, |P0  l,Xd!4 0`Q*4 80t  ?3 PpU 0!0  0 !3 @T Rp0!  ! 00 00fpabU  !000C000 R  !R .H p, 8BX0`S ,  P7027H22X2`2,0/X`400P, 8(p,U *@00S  SP\:!1pX`4 (0 Y~:0h2t27 -LP00 D Q *0 0S8 Q:7P7 -L(M-H ? 1L  0<0 \ 3 S8PX*0pX#0X0"0%00     $  004p9P0  880#00C0(0 D@K #@pPwD0 0@  `"p* R8C@: `0L` .-pP^-p TR $$2 Q 0! RG T"p0 P *H"P 0T: 8 P:  P 0!B R,0pP *!P 0S 0V 8 P:4!:P p: n`1= 1c2cd>\1   0~0 0 VUp7  !000!(0 ( !00C0!U 0S 0V00#00S !000!( K( !00C0!p0AS( 0 S\( < 0 0AS/ T 0S0 VUp  !000!(0 (( !00C0!660AS(  0  RWU `Vc  -LH$HXK -LH$HBX; -L 0-PLX@0S 0S 0S 0 p-L`ZPP" 0 `FS@ ,0S T@!^ !ASK `! !ѹSp p-L`.PP" 0 `FS@ ,0S T@!^ !ASK `! !эSp -L\@0S$0@ 0$ $ $ ,0$ 0  00666 -L$ R 0S 0 0 $0$0T 0 S 000 S000$0 0$$ 0 B 0l0666 - LRD 01 $0 $0$0 0S 000$0 06 -0 LR 0S0 00 0 -x0L@L 0L L3>#&."H,"D0#01 R 0@@0k666 -0T LP400 00R$0 0$ $ $ 0$d56 0-L@0 XL 0L3>#! L!p0#0P 0S0S0SP !000!0666 -L( <! R 0P7 -L p0!@T0 0PU,ڼ0 ` S$0  !000!0 Zp0!  B !0SY05iW@PEUXW66 -L <QpXaM Ry P g<{ D0݉Z @`FV,00S,0 ZD+2 -L- P -? (00(0e} -<00L@  0-LPQ @;>@<<HL L0R #m~0 0-LPQ @">@m<j<HL L0R #T~  ]0+2 -LP`Q @>@M<pV8@=`0!@<HL L0R #*~ !00C0!( R <0S0#( R!`0P=>P P !00C0! <(, ,0R #}!d=$\5 -L` x1&A 0A30# " A!"0#0A@T 0S0S0ST !000!P0 QU 00U T #p`008g=666d56<$ -x0@L$FAd0A AT0TP ,0Q 0 Q65D7P5 -L P -L@=P 0 0075 -L@ 0-P0L@@@@@T @0 -L -0LS !00C0!W+2 -L@ !00C0 R  !R 00 R 0S0 0 0008 -L M 0  K0 0@P  -LPpDM` UL*WJ h L0 4 @>h KR0e 3RUP#`h0@d0 d5d0K`@T * h 0 P pVF` K0@TdPKP b@Tdh 0 h0@P R p-LP`0S@ 0C0 p0@P T<0H H0L000pV 0P @ 0 0C0pp66D7 p-L`P@ T8P: [<0040p+2 -LM< @ @ZzJ`@P 00(@ @` `0``<Ḡ `|1 PU<0Z`T `Q p\a0(@#SH1  00HHpL000  0(p 0T#{@0S: 0ȐS 0!@00!T P  0@PR T0S=?08 K`PL@p40 p0Sz00<$66D7585 -Lp(0" 5[ i80`S  )[Vx #[P0V Pd @뼀@N;(0S(` !000!8`+2d=$ 0-@0L P~;P 00 {s9p9m9j90 -LP0p Z8`V0W(@PPWQP 0 !000! +25 p-LP` 80@S \\ Z0L" < (0S(@8@ !000!p+2G<$ 0-0 LK@P P;P 0 80 -L@M0p,  [Z80S0 80 P 0 bb0 <  ,0 @P(0  @m::P\ \0 00c(P`UZ  T:+2<$75 8 -L M88 Q<H `00K 0p@0  8 I8 80D  4 @ 0 b2<0 M41 <0(8< 0 Pg40  Q0UHf9T*W H d9T0#03U0S <b0 494 0 U00T03S 4 K400<40< ( @4 4 DT00R0S RhhY@ PUT:00KY 90 0  0K Y<$+2 -L M0 40 p, 8P 0 4 `R030#0 VP 0p@99Pt t0 00 (PR00 U@@TX :W,0k975 -Lp4M0 X  L  Y80 S   cX40\ P`80T0 @0T@ 0bc@P 0.0P V* L  P!0PX R<0X0 X X\ 8<a9   !000!H0K A\0T0\0 (@` TZ 0 f X H K+28d=$@8 37(, ,0R #y -LMp ,FP4 , 00 8 G `4PP "T  7(, ,0R #x+J8$J0A 000 0:W`PO T< dy8<_a :6(, ,0R #x_0 #FR 0S @1: ,J$JP80A 000Y @1,00 `P T< *Y  d<8<"a 06@66(, ,0R #x 0-L@M00 PP x60 - `Lp&ZF`@Pk4 0U40T007O -L!ƠMJz `'z00  F d i0 0cS@tY80S 08 4 (8 ,@<@ W, :P0W( *, , 0@ .00 ,0 $ 0 ,7,0 < , K,0@ ,0  Y < 7<m`,@45,0<S 8#w o<$ -pM0L4 ` %&: P* &40 Z%ZU00P 1 #R0 @P U <eB7<(` 05 -L0TMH0 ` K\0  \ p-LP`Q @;7@5@@5HL L0R #kwsUp -L`PQM, +J\pX,0A0 ` 0 d0 `#R0)66D700HHL000  0( 0@PUZ -Lp8M0" #842  Q, $L"  @r ,2W A@20q0 0 0SÀ@2,0S@2 8" <" @ ,2D Zk@0"q` 0H2 `0H2SY0H1SP2 o XKD"0A D" WPPa P0 0(P BKQ,K#R@!YL2  D0@~6 {6OK Q0c`0!\  \ ! Z 0 <P8 <<  V:`H"0 RH" @2,0S@2 Z 0/K<"P8 0 <" <82Q- 8"  082 Z@ J@`P0/K@#Sh0 I 00HH`L000  0(` 0@" R@" Z+2X$66D7 -L`((M"(80L S00 0w0L0 8 RTTU8p PL@Q 0S $ UX L0S U0"0ST U@T U@55H0KQp !000!(P U0W0XPPU 0 4 dUH Kh#+2+21:=EITWX @53(, ,0R #uX00W0S H KC -L p`P/@P8  PE 0 pP! < 3 0 0 p W0gL3(, ,0R #ou -Lp;; W  S``V Tኀ@PJ P5 `P2 !(0,P^ $ 0$ $ (0 S(`a8`000V23,0S #u !000! 3(, ,0R # u,25d56 p-L`P@M@ 0(@ V  KyTp -M8`L0@,!4 p, P0(P F 3UPp쀟@0 (P"S ,0#S0 00HHL000  0( 0@Ud#t 080;T T0'0S pd566D75 -0L 5 ,2 -L@4KP0Lp Mm?`8`  <0 3 #030   00!\,25p -L \  !000! 000 -L \  !00C0! 000 0-L4@P0@P 6P0 6 0-LP@P00S 00SP@0 -H0LS P000S 6 -L{Pu  RpL0P@`@`@T 5PP" 67 p-L0P@`PE@T U P Tp5-? 0 03Q F2\@ @_p 6 -$0L0S 0S 6 -LP0 P P   p-LP0P@`T < 0840 9@PTU:p 6`/2\/2T/2 -L&@T 偀P@ -LH`0pᄠ\@P HK1WX040W N5LPP 48P=?0  0 XD  0Q  0Rx V RQ !000!X` PU RP !000!V 0ST P !000!X P !00000!00X0  (  ( 00   00 (00 00 0 0  0 L  L00LD0 <00< 08P 64-2h5 -L@`PpS 4P >4Xp 8P 8V R@hP !000!U` !00000!0000  0( (0U 0 0(0  00  00(00   AW W  !000C000 R  !R . P-2,2 -@ 0 000@ <0 0,(00LP P  !000C000 R  !R .0 OAA8P ,2 -LM0S( 0BS,0 $\PPp@ ,30`8 !0 0 00T` p5Q0S , 0hSh -LpMP4 0PTF7P D3 P0P ,0e0S0P ,  0 R, 4h5 -L`4K T M=?080 P< c.,@K`0!^ !Ac@K@PP 0Y+ 00*' 0 pP pXPpH0P 0 0PP eDKD5 DK(0! !;@D5 -Lp`p@M!^ !A @KM X  `0@P * D5K! ! @  -LP`p`0!^ !A?K @T,, JL YD502q -P(@0(0pL0`  C0( @=0S V00  R 0S 0S uEP w븀@@H`H@@000 ,@R #tlZ V  M02 0-L@PM 0S P 30 0BP( 0S 0S 0S :0K 00000P0 ,R #*lU 0 >0 0 0_ 0 -LpMg h @ @0@PPj ( DP ?  -L0@_4 -00LS -L@=?0Ó`PTVpT  !000C000 R  !R . HK 0 Wp00ST  !000C000 R  !R .H )K 0R 0 T  !000C000 R  !R . K 0$0S &>(0 \00ST  !000C000 R  !R . J,2 -LpMlPu00S`HP 8@K <P #P0U6408 PQ.=?0P!& 0 <0R40 D Q8O<`@!^ !A>K4 $P! !(>7D5 -L --? 1L6 0<0Q -L`pPP8M 0S~<@K P `VoX@K P `V``PZX0 <0` 2 Q: S00QI80 0 h!^ !A=KX0h !^ !A=K0P  `D580<8 P ``X 0h0! !є=! !ы=V 80 0 0. -LP`M?1 0 <0 R#  @@K 7Pp PU@ 0@PT (0PER<7 P -LpPPp% `P Ae TJ#=?0 03Q + T  Q a)` -L`p&88P@Ÿ MHp S2`U$ 0S! *(P Z *(P    j T *(P-? 16 0<0Q P~  D@K P |pWb0P   0    hPpuED0 0R @KP@ pDR 0S0S6  pR2 h0!^ !Aa<K  pG( H D 0h0! !d<H0S p`0! !V<z L L0RgD5 -L`P$KM@P(.@tPPUp(K@P,K@P ($ ,000 @,(0$7 -LpŸMH ^, , CTv  !000! 0 S30 S0X 0!0  0 !W R9H0!  ! pY 9Z  !000C000 R  !R . H` V3P U0X 0!0  0 !W RH0!  !pV 9U  !000C000 R  !R ., G},0 H0 S,0  5-2,2z -L8M=?0!p& 0 <0R \`Pv00S` D@K ,P  `聟V @`Pv00S` `@K P  `V3@T !00000!3 pW 0S vG !000!!^ !A:K`P0h0!^ !A:KD`0  7 0R 0\0 0R 0U)@ `R% \P" `FP 0S S7-2D5 =P @0D``\ 0D @0` 0h0! !ѯ:! !Ѧ:8T  !000C000 R  !R . F ? =,2 -L#M, 0 4" 82 T P'@ h3TL $;<2 X" Q 0!R+<" K qlD AT.L"R*z.L `2L S 01L2 8L0 0 S R8"YL  PL2S 0CL2 8XD"8 }TP 00?KPT"(K 0 S ZT" RU /Kl&K  KP R0 SRPR0]80a80e8D@Pa4" 42P\ eP \ R 4 @2? 00 0 3R  K%P 0" 0" 0PES 00002 =?0 0003S0PES0 K (KP"\T2 ``RV 0S 0P 0 0PP `(K V`PR TLVQ P"RLT2V P `(K VT`V\Q ,"0(0 p-L`PS S0  41S /!K5 P`V 0 U0V `$0 ( X p0a8Р7 -0L 0-L@PU , $P00 0$0000 -L \ 0S0!   ! \ -L("h";">?0⌠僁 pPP l@P`P00PP  0@ @P6P6 -L@ !00C0 R  !R 0S ,, C  0ݽ052P6 -L`LPHp+@0 R , 0 +@PU<52T6P52 -L 0@S0!X6 -LP@ !0S PPD0  R R @@0T6 p-LP@PA`0Sp'0P00ppT6 0-LP ,R H0ՂQU0 0S P =TnP Z<P 4n0S 0X6X5252 -L`pM0 ?@ P\  d0K A/KPP<@| PR $0S 40S PPU,<<|0 $PC  -LP|Kp``M  K0@p 2l0 "h (0d0 , ` <0<0 @ 4 K#D0%K,0 4H0P KS\P` !; R ~?4 S?04 S 0D0 +H H0 L0D0 =?0 ` 03Q|K E \  p-L` 4@K MPP40|0S 40S PPU40P p p-L`4@K MPP40|0S 40S PPU40dP p -LPpi`P @0|0S 40S PPUDP -L` P0S 0S 0P  0S00L6 -@ 0LS 0P00 0SL6 p-L 4@K M PP=4 2P: S8 PP440 UPu`*0PS$ 0S! 0@T 0S  nP  P\  !00C0! 000u@Tn L6p p-LPP` @=?0 03Q@T p^ PUpp -L0@M, S0 }@ =?0 @@ 0 3R<0 ^WZU 0  Z3\ PJ 0@1S3X:0h40 0X1Hڀ 8 408Z#6Ap%Z W  p8  Wp = YU<` U PJeT`@Y hQ eC< 0P 0 3R  P<G<FU d4 X 4 @00C@0 ,0@@DS,@  -L? @0 0 3 0 3?h=?0 @ # T   #/ -Lp0@S (i,0$* 0!` RP $6RP@T 00  F00C0TC@DGA  A@?0;AT R <F=<dF<Fd:27:2 -qL-? d`,1\pP010,101D!001|PP , 0!^ !A0K 1 >00d00 @,@0@4@<@Q,ጛ, ` 0CP#6h0!Q 00, d00d0 Sz@T,00! !07w -LP` 8@K M Pp | P@U80 0 @2: S@P84 t@t=PP @G -L%p@PM K`0P\ -? @  3 0 3? $0K=?0 @p # T   #/ -L=?0,p@W 0S P0WPEaጚP0WEa`P) ,`PPP`U Et)taW U `` <a !00C0 R  !R e :2 -L-? Sp0@Sڐ2s`P ` 00,600!c00!`V`P}3S  !00C0 R  !R 1៶0<3$ !83Q4!01Rh00h0(0S #. /S Q00S#>0  v-0S 00! 0 000! 1$!lS| !41R1 P h00h0P30P3kKcP0!@pT 00 vP@0RU* 0U:00!P vS00!7 -@1 pLI =?0`$  4!P! (0S 1!0S,01yWPaaa|1   1S 1S011 1S01<1! 00`S`XV6 0 0 0!  R 3 R3 R3 RX 10 0 <0 RV 1< 0 <0 R c 0P45<5 -@0L-? l1 Q0 101 1 !,1$1(1<4S801P10 h00h0101<5 - 1LS 1@ʠ,ʠ \!6!< ! 0S 10C 1 -L`pT@TK PUE  jPA pP&P  !00C0! 0001S 0 !000!P x?h 01 h P  !00C0! 000w1S@TwZL6 -LNM`1 cPu``Vp@K0WK\0 TP 4 X` 0` \ ,` !P`< U 0 !000!<M\ !P8 U 0 !000! 87~PP4K BPP8 \0 ,0 PP < PP`<PPT0S 0 !000!TP @P -@T -LP=?0@T \  !000! 000^T P  !00C0! 000 -LM-? TPU> 0S; h8 ,0pW40h0!0R.: 8 K0-< <K%@t``V00"R2: S0S 0S   P :2B -L`4K0 M]?P8P  <0 {# R/R40R, 0c00  00/S S  4 0.S`00S/ S[0.SX 0R0QL 0R @T RL30!  !$@5PU2 U 0!0  0 !0@T R(+30!  !$@P  !000C000 R  !R . 3P0`P04@KS 0S PP eP8  zPu8 8@ 0RK `8PK0P< @@ 0R2T 0!   !@P  !000C000 R  !R .t 2l$@T RD20!  !0@00P0S8@  0R`PV\ |0PESX (0S" D2S0D2.0| (D2P0CD2'P8)$UH0`PVA |0PES= $800|0 PR3 +<2<2 4 0.S]00S SX0.SU 0R0Q  0R @T R<20!  !#@PU U 0!0  0 !0@T R(20!  !#@P  !000C000 R  !R . 1PP04@KS 0S PP X R8 mPu8 8 @ 0RK `8PK0P< @@ 0R2T 0!   !@P  !000C000 R  !R .| 1^#@T RL10!  !0@00P0S8@  0R`XV! |0S (0S D2S0D2-0| (D2P0CD2'P8#U;0`#800PV ! |PEP) 0S% #<2<240K004 0.S 00S0 S0.S00 "PU8P  p-L`PMP@0 R;00   ?3P !00000!0 3 @T Rx1 !000!4@ 4@KYP40 R ?4,0K00<23p -L`4!M=?0dPQppW& 3P !00000!8 3 @T 0S 0 !000!<@ 0<K(0 P8<`3 @ #`P P"T  !000C000 R  !R . 0>2<2<2 -P00p0L/SL=?0 `R% # P !00000!3@T R^0 !000!@'P 3P !00000!3 @T Rp90 !000!@?3P !00000!3@<2 -LPp`@P!P0S 0S @P p@P $ @PP |0@P@ ! -L M  R /R n># R0K 0c0  -Lp`h@t00SP@ 9P  @07 -L*"*=?0Ó@0p`ih0!^ !A'#K RP0 PgPU |0 PS 0S  Ph0! !#U0 6/ -Lp @@ßP M4 `0   0S  0 P @T7K P @T*0@S$0 QP0T0!^ !A"K@, ,@t 0T0! !ѵ"0S0 V0@T0! !ѡ" ,0T0|4@ u0T0! !э"@ 0RM @D ,PK0\> @L 0R4T 0!   !@P  !000C000 R  !R .X .g @T R0.0!  !@>2<2<200\,0 0R @R{ |0S (0Sz; ,000@S 2: Sj ,0P@Ue 2&@D: S` @ S[4C@PV2: S S  S S0 @I|0 @ @0@ 10S8  60S ,0  @@T( # h@P"0 @ 2?0:: S@@T, -@ !00C0!TFeA'@ >*,0| (@,T0S0,0 z@S 0 R 0L!Zh0 , CeP0T0!^ !Ad!K , 0.7 p-@PL0`T0!^ !AG!K Rp V0 Q 0S pYp -L`PM?@8#ph !^ !A!K: S S 13 0 <0 R 0S`0 `J`V |0`S \  0 `h0! ! V0 - -L`Z U0("MQ pwLD@K P `V:_`v% U U U  U  U  U  U D0 \`D0  0b`` D 0T0! !њ H0N7 -L@`ph0!^ !Ah K RP0 PPU|0PS \ =?0+0"+  Ph0! !U U0 q, -LpM>@t,`P 0 @ @K  0 PPPʽ3%p -LPp X m@?`T  0  003S@@  000 3R0 003\("", 0 0  003S  x 0 000 3R @0@0h0 -L`PpMս@P ,P 0(0 $p d, K 0 `P(  `R =?0 0 3R 00$0`cO4% -LM   D @ R LP?U 4 KO 0  0 3R4K <`KOpKPVP g~0< K@D 0"K*0K 0g 0 3R  0 0 3R@ 0 000 3R D0P0PD 0b0 -LP@p$MK`P% ,@ 0(0 $p , K 0 PP( PP 8K  -? 003Q 8K $0Pcὼp6% p-PLU `@@DbC嫼TPUp -LP`@pT 0*0SըP =?000@@ 00!000!=?0`p 0C -L@B` =?0Pp! 1!00 00 0@D!pG1  00V2``T -LM8 p @ P 0 K@04 ?D S00<0 000 0D 0040YK B1  l009 n PP 0,S 0S < 0! 1< 01 0!  1< 01 0!  1< 014 Y@0<0 Q00Z0S D 0S00S=@ E0KD00@08  0 -L -L≘ -L0MH D L P0 Y$ =?0 03Q PPU0 UPR0?S2P ',2 /A&b11!D HP^?3 PT ^ࠡ@bqH PX@ Z 1<  008 "40 0@  00  ,  T  0 0 3R @@  P @PW  PUL0X<S2 T 0L 0 3R 00 P0 0P\ nUP X8R2 T 0P 0 3R 00 P0 0PGh\ LUaX 42Q CU0 >U, 9@KHD KPY$ Td0# D P 1/b 11@"l!! T   000 3R 0003QU"T0PSQPZ4 X "!L 0R X0"!P,\ X "!yQ -LpM, W)*1P`PԺ P@P 0lPS 0S P008CXYU 000,pPWE: -LP0M`}00 ?p0,0 00@T* , K00K@T:Z , K00K0,0 0 V00R0S 0S0Ps;`000 -`$M=?0p L4 D0 QW 0W 1pGq @00K< W0@   @ 4@P 4AHP 4 X P u H XX  P i P U< @D 0ʠ 0 3R \NJP UX D  0 Ɔ  0 3R  j^74@0 p 0 0DP U8 @p! 0@`TP UX @ "Ġ0 `@T8Q< D 0S< X ȥP UP U40S 60K< p-L`@P0U=?0 R p -L!; -LPr`T0!^ !ASK @T0S}P 1X@S' S cSE `X20 $00$000S00SP0  (0X0J(=?0 RNA0p  0 @RU 10 (00(000S00S&$=?0 R0L10 000000 $00$0(00(0 0S 0SqpT0! !т 00CS0 00CS0!H;\p@0SQ fT0! !Zl555 -LP =?0L("Q:(0㦔P -? L20L2X6 -  L 0  0  000L(, -8000 @DH -L R 0-L  00( ( ,0,000- -  8 0@ 00@D0D0H H PP0 0-L@PP =(@?0l , -P0 0 $08 @D H0 0 -LQQ- p-L0S S #S `P 0 040`0PoV0S/@0 0@8 R0Sp<0S80s00` RT80(0,0 @ D =H ?0# lPp -Lp0S S 'S $`P 0 040`P`V0S  0@0@8 R 0S0S0 ` 00 `80(p0,0 @ D =H ?0# l0SS0-0 -L`p@P ]?P30l (` 0,0 (P L20CL2 0R |vC 0R hpC0 R TjCP0Ꮣ00 , 8 @DH@XI2I2I2X6 -L   00 00  00 p-L`@ M 0 PS -008 P0 D 0 P 0(0 P`  0I25p -L` 0 pR P @E@0S #E9W -? (00(08 0R -L@ 00 00D 0R 5 -@0`0P` 0 L0pPP (L0LQ 6DL`H0S (04\  0-0 Tx q-? L20CL2  0Q HB 0R 4B0S $B 0Გ0J2PI2XI2I2I2X6 -0-LP P -P -CTJ2 -L,0  0R 0RP 4 <0R0 80R 4 <0R0 80RP  -,0L ( (0R-0 -0  -LPMM?@(@ 0$K`$ p 0 00! !| P'76` D0R`!^ !AQ K,K3<00 0-L@ P05 0-L@P P05 p-LP!^ !A K0 @`@T ,0 IP ! ! p5 0-P@L UT0 <0Q  A0 S0S Q05 -=?0L0!^ !A K  R ,0 0S ! ! R 5 M-LM0@,  i]?P30T@@l 0,0 -@@0( t108`!^ !A K, @T- ,0' 4 <0R&0 80R! P `Y 0 "` cP `P , 2?0:: S@TZ` L20CL2 0R 8@ 0R $@ 0 R @5PI2XI2I2I240 ! !: X6 -LPp`M0W, X$9PPX 000 @ 0T@T ,0 (0V-0W#  R (X X@RP ,0 S P@T ,00 PU -? L20CL2  0Q 0n@ 0R h@0 R b@XI2I2I20ᄐ X6 -LpM4 8 @0Pc, 4`0 , $PR 2!^ !A K-0S `V ,0 P T JxP*P`V`V ,0  0R 0RQ 8--0\@0@0< Q80P800 4@PP00S0P0 00R000 000   0R8 80R  0 Y8pK4<0PG0 80RB4<0QN0 80RI\P0 00R4` 0 0Q8 80R8` 20P 0@0R0 00RY 5 h 0 P-0-0pP0`V  0R 0RQ^ Y -0S- ,,b, 8Q 4 R0040 0 4S 8 `P80@0 $4\ 0 `P8 0@! !я,Q -? L20CL2,   0Q ?,0 0R ?, 0R ?0,(0P -? L20CL2  0Q 8>0 0R >00 R >5XI2I2I2X600 X6 -LPp`( KM2H"!^ !AK@-0  ;=?0#Q5 X(PPK@TH ,0 E -0-0< X =?0#Q P1 [L- R ,0 D!'U=?0#Q P10S11Q( PP?ڔ@T ,0 P! ! X*(\t "-? L20CL2  0Q DC> 0R 0=> 0 R 7>55J2PI2XI2I2I20 TX6 - LR ,0  -0 0@7 -0 LR ,0 - -Lp@`PPT @<@@@D@H@ L0(  -L`M=?0,P(p0 \ 1 0 <0 R  2: SQ0S0S @!!^ !AK0 (0S -0,@0S,0  ,0 S Z00Q0SQ 0S PXX 0 0PPQPM 0 RPH , KPPC,0 0L0PP(,\x 53L20CL2 0R P^= 0R <X= 0 R (R=$0 w55PI2XI2I2I2X6,00, d , 00 0l < 1@0$!D ,0! !ј55 -LP` pP9 P0S S S PPPPU!PQ 1 l@!^ !AJK   &P! !Si5 -L P@lM? 0p 0 3R K ^n8[PSj Pᬰ`Pe PE|@K KjP[ 040S  PPPUO0[S0P8K. 00 4 JPR800s480 rs Sr#000 8 0q0s 000c0 00 08K-08K 0 0 3RK \ PPޯ -Lp@Mf `? 0P 0 3R4K \I`"@PD 0 0@ 2?0:: S0 `FR0`4 KP) 3[ `SPm%`m%xm%pm%pm%pm%pm%pm%pm%1 1 `040S  `PX  `uU\ L20CL2 0R 4; 0R ;0 R ;PI2XI2I2I20X6 -L `PtM? 0 0 3R K ^^9[`SZ `ᓯpPU `FPK KPK 040S  `P@VS0[S0P9K 00 0 K8K0 s0s ` PU`P``P`@IK-09K 0 0 3RK \ ``ծ -Lp@M] `? 0P 0 3R<K \I`@PD 0 0@ 2?0:: S0 `FR0`< KP) 3[ `Stq%q%q%q%q%q%q%q%q%1 1 `040S  `PX  `lU\ L20CL2 0R 4: 0R :0 R :PI2XI2I2I20X6 p-0L PR" 0!^ !AK@`,0 0S@ R! !p5 p-P0 LR# 0!^ !AK@`,0"0S (0S@ R! !p5 -LL@!^ !AK! !Ѹ5 0-L@lP!^ !AK 0R #v0! !і05 p-LP`@ M(Q0@ 0, P 1T 0 l@ 2`!?0:: SD < 0n  -0    aP-  @ 0 0 0  JPT Ꭼ00T :P@0 38 0Ps00sT'J2J2J2J2J2J2J2J2J2K2K28K20K2HK2@K2,K2PK2XK2dK2lK28  P0$0  0  tK2p -L`p@qPQ0 000S a@a  0 00 0 -LH!M4 8 <0 , 0 !^ !AK1PU* , K<0K@ p`E,0 ,K0K 00S@0T , D0  @ 00S@ 0TPT0UD! !у408 ,0< cP55K2K2 -L`P@p0!^ !ALKP" ,0S-0S <0U80T40 S 00S S-0  @`P! !45 -L`P@p0!^ !AKP ,0S<0U80T40 S 00S S-0  `P! !5 0-L@Ps  !00C0 R  !Rf 0PS00St 0P0S 0S P 0R 0!00P 0 0P!000X000  00, (0 0\  8 80 800P0S 0S   P0 PS 0S @`0P 808 0T0C0@0 M2557\6 -L@ 0R0 00R 0S0S 2: S0  00 -L !000!0S (00C0  00  5 -LQ @ 0L 8LR  !80080 !80S 00C0 L00  Q5 -L@\$ 808LS !80080 !80S 00C0 L00  0L  00\5 -Lh1p@TT Ta00C0 0 0@@ PD 0S W  0D  00 (0 0\ 0080 08  P0S 0S   P0 @S 0S @`0P H0B0T0C0 pW @T55 M2\6 -L1p\  40S 0 @\\R La @@T0SI ^F00C0 0 00@  00 (0 0\ 8 0 800P0S 0S   P0 PS 0S @`0P <0͆0U0C0 \55\6 -L0 @R000\ (L 0R0 00R\P (  -L@P000^ `|p(N0S   0 00 0P0 00R^T ( @ @5 -L@P -L0 Q 0\0 05\6 -Lpᜁ`@PP PP5`P  00  T @P0D0P \ H00   000  80  0 W R| !000! pT0T00(  (0000 (0  0  000\6@L25 -LQ 8  800  0-L@PP ,x@P 0 @T000M2 -$M L`p23# 32,0 1P0@E U,0 9 H0P S2 0S/P0S 0S @ D0S ,@ P !000!0S 800C0  00  d6`6h65@E U -L@0^, H!2@!3#31,0!01P@ 0@^ !000!0S300C0 00  (P#0 R 0S (0S !000!0S 00C0 0  0  R@d6`6h65\5 -0LS\  8 80 800P0S 0S  !0  00 -H0PL 2@3B# 32$001  d6`6h6 -Lp0`S600    00(P (0 0(@ (0 0``@0S@ 0@0 R @ 0 0D D0D D0H H0H H00 00@(0 0@ 0 P( 0000P0#P 0R 0S PmP 0S`yp 0-L@PU# 000@@00 00 0TTP\ \`000hhPp pt0000 -L^ 0 00 R 008  8008 -L`4K T M=?080 P< Z,@K `T:0bS0ar R ! R !Vq V 0! @!@0! !0! ! Z X | -LQ@`0S0`0 !\00C\0\ R  !R d0S h#! -L@tn0h h0l00000 -LpP`UD0B{@P PU@6 p-L@`TPM! 0 K[T 0S{0@m{T6p p-L@0`Sp%{PP p R{p!0S{P`p -Lp0K0Mm?`4`  80 \0S, hP8@K"%|P0S 0!@00!T   0@R T00\0S gE#85 0% -L R 0 1R -Lq Wpp WP81 R `2: S W0}zP @  @T 0ST W 000 00 1 W=?0l < @$!H0D P0!0 0 0 z56TOND -Lp`P@T 0  0R x+ <0<S X ]0SP0< 0pmz@TW aTONDW26 -L% -L@"M0pS0QU-!01R 0 !000!坝Q PHP  PR0r S S 0 S S0 S S 0SL 00 PK0Jo0S S S0 S S0 S S 0S k P'  1R0 1 K P 10 1K P 10 1[0s 1P#! -(0L$ Q`\ -Lʠ,ʠ\ =?0 l 03Q  -Lp᐀` M X,  d PbP0@CV00X0D 0c !0c04 S @ꠚ77@0 0@c@D00 0 X @D 000P@D 000, 0 * 0  0 S 0 V?R P@Dd B000 0 0 0  0  B0 "0  0 0  0 B$0 A (0 0 0, 0 00 !40  80 $!<0  @0 0!D0  H0 4!L0 0@c4`0@cPP@D0`@D0P0@D, 0JSTp I0 0pP 0W03Sp 0JS00, 00\pSXp0p` 0W03Sp 0IS00, `p -L0,M80 <0 @0 D0 1, P0 0C8S1(S$0 2  ,0 R 2 S2B TNxP4 ,4 0,PP28 4PRH r0Si ?p@@0@ 1@<S008,0 0!^ !A|K!0 L0 `>0> 0a| * :#:S ,0,ƠVL ,00! !k<Q 1S>L 00c80 0<0 8 00D S!D 80@ 0S!@ H  P RH D0>0RD0 `Z08 0P 43xꐚ7 -LM?, P0<0 @, D@ 0, 0L0p0 pR R 3L0R /0 K`  0R R0 0  0+ K iZ0\  (0K P R Z -L M  \K@@ S` \@K  00P4[0C8S}4[(Sz80 x3 s 10Sn 0Sk #[3[ `TewP _ 0 @0`Pnӕ`Pk@!!000!-? ` 1pAS  ]0A@ 3[    P B0S8 `R' `vP 3 0 0嶿`P&P u `vQ 0㠿`PKK00 @3[\ ^! [@!@1 QQ Q K .PO`0Q  0Q00S  (@1S\@K @ ^  K@`P 10 1弿`P,0@`, D`,0<`, `D0 @00[27([2[2[2 [2[2d 80RR 80%,0@d@|, 1P0# [ Q @ 3 0 3? 3[@PQ} 43PP 1 0P4[ PS00  ,0 0!^ !A[K! `>0> 0a| * :#:S ,Ơ0T,00! !LP  4[ bS 0>0 0c \ 1 0 ^ 1  Q! 1S 2 #R01 0^1 Q!  @3[Q w  3 0R0 0 3?0 00 @!0 @ @   S! + @TKK K \ 0 !000!u~ (&u  *[2uP 嬔׿0@00 0 @S@$!\\0K @0^,PT@K@@T@, 0L0H0A,0<@, 8,0@, D,1P0kyd0AS,00!^ !A[K@*00 0C@S,00! !_ 00! 0A 3 00 3?Hd05 0@0@0< 140  00 00  `0S 0 !000!;@T  u u5 -L`pT@K 400>0@bt *:#:S  $F@0$S,0`0! !і >0V0 0>0Q`=W`t[27 -L0@ 0 P 0-0L\ @_ 0 PQ 0 0O0 -@L00 0 0-LP M@ 00    K P  P P  P P0 -MM?@,0L`PXPKWPKVPK3 ! \ UK! ! s뼤K01 HP 1 4 @ #KD0 < 8 03KK,K.R"K!S2K (K 03K 3 0 3?-? 4 0P<0\K4 QP 0kK!|4 "! 7NK300 @ 0!(K\0R:P0 > @0(K ! 3 0R 0[2\2QX\255 0 3??,0X@DT 0OTO@ 0 3R K   RKK1~K  0S R  3 0 3?M?@# |P `x` ?t0 p@ P  lP 0h0 d` `p @` VPK @o`P@T01 0C1 1 a 1 1 !1  Q sOK -P ,>0. SC6B66p`1 WB A! ! 0 1  0  0 30S 030S00S001      01 0 101 !:1 Q  P pW@ T PKP P@ T1 0 3 0P0 0 3?Pn ,0pWc  0  0 10S010S00SN 0ZJ*0** 0!`N  *6RLQ@T 00  o00C0TD  5?0;P$ 0S !Q  *fP1 kP 0Z: pW! Q 0"1 0 3 0P 0 7`\2 0 3? -LP @00@0 -L@P @0S<"0CS@0D0S " `2`2 - 0L#88S m^ $\  !00C0!$ 000 -0 D < L@ 7 -;0 0$0L 頟 -LM=?0 p`0P= @PP7 = $ P $00$0 @P $P 0S $K T@P$P 0S $K $0 R `2`2`2PP p-L@P`LU D0S @ " 0p`P5 UP0 0S 2 0(0 , 0S 4 @0S2$P  !000!$ 0000: S S  S$C0S|0Pp `2 p-P; 0  L0$0`00@P 0H R l0S 202H R~P( (, 5p !~p5$5 5a2 0-L@0PS808 0 "P 057 -L@ P`0pSP0,  j 0-LP0S \ !00000!0@T R4 !000!@00c2 -L`0p,P@U !000!@ 0!^ !AK\' 0 ! 40S P 0!0  0 !40@T RlI0!  !`@ \! !Ac2 p-L@0`SU !000! P !00000!@T R8 !000!@@*pc2 p-L@0`SU !000! P !00000! @T R8 !000!@@*pc2 0-LPM,@T !000! ` 0C\ P S:#=P0 -LpPM,@`T !000!* X0L T \ 01:#=PP0XS \ P`0L \:e\ 01=PPz p-L`B 0  : S S Sp 0 p=?0,( PQDC ,1P@00S 10 0 <0 R pV : S 0 10 0 <0 R p -Lp@MP e K$ KP^ ?3@T !00000!3 PU 0S !000!$` V $0P3 S$0 P+ T  !000C000 R  !R .l uV  !000C000 R  !R .  pc2b2 -ML00  -L RP1[# p`@}P `P} 0OT 0Q}0@TS0Pc-? @ 003Q  0Ou} -L` M P쐐,0 ?pY0 0S0 0S 2*}P + !0  0 0 3R PpP`dV  00 V01:#K<@PZ, 0@%}  0-LP@FP 000 -L`p M, |P P =?0#@T !00000!3 PU R !000!  ,:00`T  !000C000 R  !R .\ >J0C0c S`0003S  7|c2b2 -LpM@`( \PP"$K( KPP$ (0P$(P  !000C000 R  !R .  Sb2 -p MP0L8 0< 쀓`l U@  U (800 <0 P] 0@@ 8\8 <0 PH 0P@ cV !000!6 0 PCU/* 0U0517S Ʌ4K@ @xN 1! @S0   8  n< 0 P  0@ PU:8'd2d2 -pM0L0lSV 0`PV V & 00 0P` 0@  000PP ` 0P@ `F V"!d2d2|0R R  @0 ` Ȍ.PP 0@PX5 p-LP@`~P" PP R0D0<0@0l @( !X20X2!PU (V, h0 $1(04!, p p7 -L -0 L\0  0 0 -L -Lp@D`PQ00SQ 0AS 800 C RHVF1` AR)@P: P !000!- 0PV05Q7UP$ !000!:&04|00@ p0 0!=21 20280P066&J闙5%5 -LQ@p`PQ  D0R@_P0SS  -@PL 0200C S5%`%%%%%%4%(%@%T%0 |002 *0 0 0 |0 0 0 0 0 0 0 00 0 |0 d0P0X55`55%%%X5%& &%&555d205 -Lp`H0    l00 ll@|$1 0(! ,100! 4108! l0T<@@$P#R P@@1T Qo!@@1PT@,`PV !000!O @0!^ !A|KhlP0 T Qd 40 BS"  0 @h25h2 8,8H #8L0 Uv/P " 0!^ !AK R  0C `R!1 p@ ! !D   x 0$l blL00H0< @D0p00x 00! 1 0!$ 1(0 , 000 4 080 #΄H 0UL0P`dP TR "U0X 80 \0< 0` P0d0@0lph0D03 #1p0!t 8 00!| 1x0 10! <\0040 0 0gU@ 5 j2 -LM, Qy*@, 0apWv#0 080 ` 640 RV  fMj2/ + 5?DF`Vf#JQ; 0005 000  000P1= 1c2c>#"&1"1=S !c"b!a2a48A\PPU 00S 000T:40@# P:0 8,0"QR5(: -Lp8M@p Dp ,PHp < U !000!G 0!^ !AK@L0 T- ` ,` 0` 4` ,0K8` 0K 4K8K! E,8KH0@0H0 p0@    0SD  D @TL0! !s <D@  H0mj2 -L P@LM80 4 D rPH ? 8P6 ,Q<  !<000!) =?0L T\0 <0SL  <#&z0D 0)!^ !A K<Pd0 Z @0X W PZ  ?XWZ 0K` / K00K @ -r -w -x p0s0000T0 4P0 QL \ `3 P2P0  T UX  0!0  0 !\3 @T Rh#0!  !X Hʠ0`U  !000C000 R  !R . 1`FH 0 V`10H`P `00T Ơ40@S P1U F 00P1UH@` 00@Y @0p<f2hf2j28 Pid0UP!! !Z\ 0 D 0 3R  Vd!^ !A+KD Y80 D 0e80 @0p8\ L^@Z%d! !"&'J6 /0< D4H Pnq -L  -L  -L -L,0 RS e0PA57 -L p0077 -@L00 0 0-L@ MP 00    K q P l 0P P  d0P0 -L`@2VMP l!  !004pp 0$0rPR2(3 `3@ 0 0000 `000l1!B 0 `1@p ]?P1! 张K ZKNK G?Kp1 CKt V?Kx1 RK| P l10000 00  0 0  ` p Pp0d1 \ h ` 0 U _`0|P X1 0T1 0L1  8!KR071K0p16!KtlP x7xA@0D1 /@! `|T<Pa8 RP1[@P 0Q ,0 <0-? 04 03Q '\\40<8040 @P  P8  \ < 0 b:#:Zc80UP!S 1Fx00%++X03SJ `pm[P U ZX1@?TU% C R :0RV!1 0 S B C`0pbh @TW B 0S :0P 04 0 3R  P [*XX*=?0 4003Q \ 777=?0 4003Q9\o84@<  e8 4 @  P UZ#<0\h@ -LMR@0c  Z0C0 CXRd3&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&3&4&4&4&4&4&4&4&4&4&4&3&3&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&3&3&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&4&3&3&3&3&@@@@@@@@@p`1h0AS h000AS 00p[\  0Xx2\x2 0dx2 -L@M  00H Ch0CSR0A lx2 L K@ tx2 -L < ! R0 P  P P  P  P  P  P 0]8xx2 -LpLMl U0@PT,  0`V$00 R h K<0 08PUpePx27x2 0U 0`V @TPUPC U l 00 -LP!D@@M0`S 0 0` 0!pw`'D5x2h Kt p @0JS ` 0P@1S(  R  x2<5y2 -L -L!P 030 -LP  0Pbp 0^00\P 00t@ 0!0S Q 00 0 !Q 010a8 -L!=CP EMτ1C1 @ P A  dp -LpMPU0S J00Ȑ0W:00@0 , <  0S ,< t"0@ 0@ 8 @d`c4 0S0f c80 =S 1S41S 0S E? RM? R0P M?!R  ReM?, K0 `P\ R: 00CR R: 00CR W:000CW 0CQ :000CQ 0E@ T*00440ԻP 06000  @ T:,Z~X~0V~ 0 0 K700 y8\ p i|222202000 00@0R <# -L,M`4 p80 V0S uPP@ ,0D0 00H RMX!?@,1R \P P14 0 <0 R,D 0H u @ 0W :@0W:pb,@K P< [ 0SS @`m=PS 1S41S0S E? RM? R@PM?!RP0M?!0 4!01 U ?@?@ 6PU 00 e 4!X0040cATP1]: 0@TP1k:@@0T *X# P< 0 S T*=S 1S41SR E? RM? RPM?!RPM? 4!0 0040cQU:ȸ0PU: 0T2x22@U0@PU00T0S 0E4 03 0@X"<0Z 0Z < Z :000CZ! 0004sP !084^1 0S.@p0S@8  Tp840 0S004OP @4p0 T00 0S:< <0 D0b0@   d 0| 0 0 K~00 !x@0Z: @ 0x%<00C0,|@ 00C 0|000 @@H0R D# @00x22220000@@H S D# -0L  0-L@PP0T VP@0 0-LP@P PP P0 0-L@0P0^ *04P 0""1\:0H5 0-L@PM  R T@"H@0 00P4@^ 40 0c 0S @ 2$282\2^ 0 X0P@@T @00  0 0   0T|220 -hM0L0x0 8 |0 0 p ^t 0C0 P r p l0K;Pl@K "0   h0@X-` 0 BSRUp  0P 0h0K`P {PEUV h Km}PUhpKP {PUX P0R  PUU1*04`0 S0PUU1*`0 S``0@ P0X0 pE4 0X` !P @0`@  0S Z{|P22 0S xx1XP 0S!җ pt 0 Px X0U|| 0P``xQ 8 0R4 0R  0X:0S {x|\P 8 0R#4 0R 5 p-L`P0Q Q4 P`Vp0@0 0 l 0 V 0U 0 U0V `$0 ( X p5Р7 -1L  -0L80S40s -L0M@Q8 0 +x P2 T 0 0S 0 u0P zT 00S T 0 uP yz  K:| !00C0! p-L` @PU  P 0 z0S0pp -L`Pp K0MP 0S 0 @"V * 04 P0` @"T: P )z -L`Pp K0MP 0S 0 @"V * 04 P0` @"T: P z -L@P2: SL0S  47P`GI  8P P P`V P -Lp@P M`PpG  yP44 0p00e1 PԊ22 -Lp@M0PU:0\\!0=S 0S0Sg0S0 R 0 R  wV PO= R 0S  R1S R0SR0` A1 @ P A PV`#8S0=,2@22P By=CP 1C1 @ P A  Yp -pM`L0S Sp!00ȠX:0X M@HPzP UP>0"* R@@0 0048P  0ꨋ22؋22 , KP 0T00 10C1,x000x0x 0 0 Kz00 t0000000 ,R # -L$M4 P8  2S800V`P8  00NP00P0S ̆40,D :@0 000 H 0<0 p@08  Q0 <0@0WN*, KP 0S SX 0Rp0@T:6,@KDq iP 0S@@ T *p0bWp! UP 0S XD1@p@0T *pWp# >P 0S X00HS@ D#Y<pPO0!40 |0@T*004aP !0z0w 0% 0 Ky00 Ds0Sh !0 00 00@@H S D#80,wO0 p'$T<0T!0@z00@@H S D#800j4 0 Z0C0101,w<00C0w004 P2"02?,1(0T!,02  4 Z, ;4 ,  22<2d2<1,0@:H0@L@\1 0\1D < @ 4 :( S(00(1,A0A1A4A8A` 0`p p-L@Q 0`dQ# 2 * Q@% AQ 01@nQ 01@Q%0N 00cQ"R 01@@0N Q% 0 0  p؎222 -Lp` M,@K40  P UPE p @: u 00 0 qZ 004 F0004 4 00 0W0000cH Ka 0h0K ap80  Sw40Ss@H0KP n@T -LPMD pR# 0K@`P 0@m 0`P   -LM4 `80 R℀  ,@K0'0 P #< 04P < 0 400U0:P mp0p  ,0K9 0 P,4  0@^4\4Pp00 00@ (1:(1004P00 9P0P ~m0Z P 4 PP 0P img0S0< S*0 < 000RMQ 0 000c0  P8 00R 00 x180" 0"& 84 (1 :(10D@G 0000P0l0 0 0 Kn00 Xh0P mPB257Р7 -LP`M$ p04@U5$0 PP- T"V 0 00`` 0$00P0l0 0 $ Kn$0 h ꤓ2Р70`$ P@U -Lp`P KM@P ( 0 |0x0 0 R@D 0PU P  20C2 5@55´ -L`P$ KpM@P% =?0!, (Jf@D 0PU$P 0ᖽ 20C2t$ -L`M2} S*,pK PPw 1!|0 04 @  L0@P 20C2]DZ4 00 00$! 0x! 1  00 0 0C000#$ #8 0 x1 0  kk92" ;20 @D 0P, 0"( "( 552520崢, -p4M0L℠S 40S ,@K0 PP,,!0\4@0 R 0S WPRP  0>0 `@00U 40 0T:U zk ,0K6PP 0`4@ 40`P 0S U _k2̓22220`@80 S40SU Hk -Lp@PM@D 0Kf`P7 @pG 0 Q0"pGmP+   *pP%2S  > 000P040r  42X 0C20@0D0D0 (1:(1$V j$202Р77 -Lp@PM@D 0K`P. @pG 0 \'2S 002  pP(1l :(10@D 20C2߾D0D0V jT2`27 -Lp`M⊫0 @T#A ( KPP: ^<<T2 0|00 0rP(  l0 |04 0O0᝾@D 0@T(@ ᩻ H55h5 20C2ᄾ( p-L@2P: Sp2} S:p@D 0k`P p2P 020D\ !000!jp7 -L`@PM@D ,0K8 I040 Pp ,0 Q@D 00K@98 P Tj8 2: S!T &040 ;P  40K4 PP 4 0P0U0T0S 4  2} S*80S@D 0P4 v'000 x1 ,00  h!0800P0i0 0 8 K~k80 d8P i080 0Dǽ, T 2 0C20D0᷽ (1@D:(1ᬽZ% 4 0 0_i 20C2᜽T 20C2ᒽ Р770"( "(ᄽ040 Z [iY Wi8P Si4 -p- LP 0` .000303i00L@ T@0#R 0+ 0062" @0T 0#R P{ 00 0ؖ22p --@` 0 L .000303h00DP 0S00 00 0 0062p -p- L` ,P@ᥫӃ 0706$2p -P 0L >03h@p`MT0P h@T@@P h@T@P h@TP h -LpPM`CᾩPP =㪥, P ,00,0 D6P000$-P0<0$P ,P[ 0SX PT P000 @P',P 0S|P0`000,XP0P0 00,4P000@00,s ܨP רP000ΨP000ŨP000ἨP ᷨP000ylᮨ@P,P 0SD,,K ᧩,0Sd .ᗨ@P,P 0S,K ᐩ,0SM ဨ@P2,P 0SB,K w,0S4 x6ꈙ2L2P2X2`2h2p2222ؗ22222$20282@2H2T2\2222222@2dHP TCP D>P 49P ᫨PP`2l2t2|2 -L@pPML0`STpVD>08 03( J3"S:`같22<227D`Q @0 0S3#08#8R303303 , gT!00  <<00  00  07ؚ22d2l2 -L`@M p0VP5*rP0!4p\:0 \:hd \:\:DD \:00S : 0 x22ě22P p0`V: -LM8 0 02K`Ḡp2K@4 td PP[0K* K,0KTqUφP d U 0ᴱ8 0p 8 fP 40Ȁ3#R$ 4 R ᇁpYy fvL0S `0  w4 0d0  k 0 00 02 S 02  S  S. dP 0S*Y Lf  [d0@ PEU8 Ჲp 8 pfPD40Ȁ2#R L0S lT0Qp1 0l1 p!\0t1` x!d0|1 ;Q $l 0 @0$ (PP00 B@2[ĐS2[5X12[S5\1#> .!8#8S@(@$@"@!@d8#8SLLLL$ d0LhR 40S7 Ẁ< 10^ 4 R+ ᮀ(%,2SP22Ȝ22@2p222 R P!\8  Q Q 0 c @⑰@⌰pZ<PPU 80@ e0 1S@Tlq0P Xe@T<@PU:P@T0P @e@T<P EM1  P U --p0hP(PU0P ePUq<Y e(q2$2P2|22Ğ22(52   - 0 0 @Ld007 -@ 0L 3 08#83 0,0007 0-L@V?M0W1KPKK 0K0T1 K 0 0K#P. 0T1![X!1[\1 0 0P R R 3>0 3$0 , |d00 7>$P 00 00 -LPT1p|1  `0@V *P`0@T:`0 f! ⒀(l00  00h0 00c0 P03050  0$0S -L00 -L0 -L0 0H  @0M?0O/ Q?0S/00 0TX\`h 2: S 0 00c C!2: S0000$10(17 -L@P0  D KL!S?R4!M?R @r48̢22 0-L@Pr%P c<%0 0fR8 ;0 -LP P 0-LP @KlM0 P a$20 -L@`Yp@MiV% lPKDc R 434R00S\A0S`A0S jK (0 K0(0L|Kx0S 002"`$0   Q3: Q#0L  PRP\@  00B  2 0 P ,  P 3: P # 0B 0! 0A 1 0!0  P 3: P # 0B 0! 0A 1 0! "(0  0@0<0H0D0<0@ 111!$0!D!( H0,11100\!4 ѣ9P8 i( Ix 0~0K@K40  10S0 \0n00 8[S (K\|K KLI@PD (0 0 ꀣ2x2L2ii52p`5 000#80:P& (0 00S   (00S   (0#50S   PPP  D  P (0 0(0Q;Y ṳP( 2P0( \0 KTP40S040,0S Q3: Q# 0B 0  0@ 0 0 00S Q3: Q# 0B 0  0@ 0 0  0(K 0(C 0 S01@ 0 Q0P K0 R0Q`1S0A0  SR  00B  2 00S   0 S 0 S 0>0#6S0006 00>0#6S00060 Q*5P52 Q# 0B 0  0@ 0 0  R :00 S 40S S040e#P0 .&2#l ݹ*PP:@SH0\#88 ԣ22(2H2l22Ĥ2 -L@hM(0圠 \ KT,1P0I?0$ K 0$C  0@d0! 0A 1 @K [\0KB@DPvT0K [m L0K [dD00( 40R0 40R40(0 (0$0 ii al00 0002 0-@2L: SPP ᙱ[AQ  0ARQ 0 0-P2L: S0000T@$10(1K㞝@2: S 0 00c0C107 0-L@R޺R0 -$M2L( SpL0 ("D0\1"* R|0H1H!0  R414!|0 R 1|0(0@ \Z(@ 00 S@K@K (\0K@K4( ,0T0K H @(D d@0H < PDPA? @C/ E?(00 G2: S 00 p505555h500$10 (!( ~7 -LD 0Q0 0R L 0Q0 0R 0-L@"PR 0*:PSP<PPP  0R2  P  PP0 -LPpMT`ࠟ0 0@ @L@?\D c 0 D R%@LP pP ``bL `00#0/ /0 48 202<2 -Lp`05 $0S/L00P!@ 0   ̷Է 0U`P gPV 80  0 0`2&4822ԥ2 -L@`pMpPP O22: S 000 0PPPU;@K0  PP00 ; @K0  @BQ 0R 00P}08[G? KC K A/xK8[08KJP 2 -L0M? U !000! 0 T * P@K7?T  X  M?@`8PK4@ p00 ?  0S0X0 000 X PKT 7?  M?@`HPKD@ pPP ?  00 0T -LT80!$0 0bS '7 -L@0 +O\ 0-\@0L TP 00R $ T xO0JX2 -PM`L"0 @ 0@V ჸP s? AApP1$ 0 cRz??0?0唐K pPB  0 @0p,@ |twT\ @0  @ h @0 K 0P 04 X1@K0-  F (pP 0 4 @ 0@p648L27p2222020 4 0@ @%?#08#8?p2 -L 0p$M4 XW80 \ 2SH0  շP $3   0D 0Q0 0R L 0Q0 0R 0D0L 00 P2 :* S00`\0V00K0@K`G 080 R0100S @4@ C/0 S00 S 4 0 G 0R0 0R C 0Q0 04@R@4@ L!S?R 4 0,S400@S0Kd A0D0T E<0 0aS<C/ 0@0G/`0 K4022BB(0(0, , 0 80`P` ;DTs:80L00 ꔧ2ħ248227<0L08 H 2: S S4 R JO0 0bS$!2$: S0 P 0 P2: S00$10(14Q 8" 0l2 -LP s PP_ g55 0-PM0@Ll 0 ` 1   000$ P0PT0T48P20 -Lp`M@P\0  P 0@ @001$ T0 cR48d27P 0 p-LP@`l0  ` 0@ @mL1$ T0 cRP."p4827 0-LM@PP0  D H 000 P0PT0T4820 -L - @LPƠ$zf@P0b4 0U40T0 0-M0L PS @T 0 0P  0n 0P0 -LpM@P``0  T 0@ @0P01$ T0 cR 4827 R U 0U&  -L`pM0P@0 @  00,8 0t-0Um 2?0:: S 0 X``60S ,00S $U482 0T0!^ !A`K 0  0P``T0! !bV. `P' `0HS#-0S  0T0!^ !A.K 0  0T0! !1 -0PL106 -L*M  0  @&#jᨀV 0 K K 00 ( ,

<$X0 㡕@㝕,0S # -L4M@^ N 0 Q<0 0<0 -L p P0G P 0X r  q5l7W) @0< 0@0 < ,!0 0000QPMpT10T105@0b$#0@0+Ap  :pP 0 0T Q*4 `0@#&Z Df QR  W  7خ2 -LPp`0S @@DJU 04<  800R8p000TL00 0\  !J46 蔀0000 -p0LS$ `H @PlḔ(,0,@S #@08#0@00Sخ2 -`1 M@0L p 0PP WU?T10U4 { 0H0PPL0 , 0(0 $   x0  l 0@ @04@K&2,K 2CF206&&48H2  -L(0K@ KMP` pᬀ0S  (0p`PVa p-L@M_ 3T!`41 fT!R  S00R 6p鄯2 p-L@M_M00 ]T!`41 fT!R  S00R ꄯ2p -L(@KP`p 0KM00 P `V -L(@KPp` 0KM0P {pW -MP L, 0@,!0  T!U?00 RM T1C `0S ,0S@L, *B, @D< ᎓(, ,0R #x` 0 0T4@& #z@ f80@@P0@0 4822خ2$#0@0UkiT10 S -`M0Lp@0  0*m0 PPPU0P0  R:PU!P ((, ,0R #482 -L W,M : , R0  @206 -0L_-P  06P2 -0PL.<6 -LM 0 尀 81  ( Ơ!z f@ 0@ @P00K0 K <00 0 p@#* @P0Y 1p P0   9[`0SG?C? KA K 9[09K V㕒 482V | p0@P00 4 0 hU40T0Y0 sQ2 0-LPAp@@Tj0 0 - L4 `z%&:P  Q:40z'z0WQ:0 0  R: 0P 0=P -L0     !J468 P@`p\ =?0#Q,0 -P40S 00S<0W80V\ -LLS@^  0 Q<0 0<0 p-L@`0PS |p@0hP 0  Q:P 0 Q*00Pp頴22 p-L@0PS``V @0(  0P0P`p2 -( ML, 4 p00 0`PQ 0  0S 0Sʼ0,@P P@@000$ $ (000`T*\ 0@ =P?0l r0  d#=?0 R548,286T2dS0 =?0l TV V1 !000!, 4 0080 !000!4\@T d0R X ㅲ@0<0 !000!!000!ꌵ2J,2 -@ 0 <0L0CpS<0d 0R 10S+ h0S& @0L 0P 0@@`! B`!R  L1SoS00R L1S4!M?R@0 O3<0w, !00C0!x@ !00C0!#0S@ 0S(( 22@2p2$2865T2N -(M0@ L0✠H <00<0 % P@K'.@0 M?@$`8PK4@ p00 @0 0Sl000+ PK/.M?@$`HPKD@ pPP @0 00 0.  -LpS0CLSo\ W @ 0S 0  Q  Q 3R@0 <00<0PU  -LpP`U 0@E0 P aRl10cSl@0< 0@0 < Q  7 p-L@O_ X!`<1 fX!R  S00R p\2 -Lp`M, \ 0CPU" V@EP 0S 0  Q  Q 3R@0< 0@0 < Q ,  p-L@O_MX!`<1 fX!R  S00R {\2p -LP`pP# @@  0 0P40S_4 0` S V *0S @CQ  0R  -L` M,  @ 0 SL1S ,   0 0R SPU @0  <0P0<0< 0@0 < QyVO LPV) @0< 0@0 < 0S@0`1L!0`1PLQ<00<00 S@OX10X10 `1S  0F  , 0`PO ~P 0!0]=0000!0}?0004 S40  0, S0 S0  O?R\ X00S*@0$#0@0f|zX*40h800 R400c80@0 272$#0@0E[ -@M0X LQ:  0`1S 0 -L`M0@p9PP 0S 0S  000CPX -ML, 00 4 8!0 00$ Ơ!z f@,@ @P00  R*, 00 M, 00 `v@@t  0 gP@@TT%80 Sz4 @R 0 OPTP@0T0 48240S80 S Z80 ,4 T⛍482 -LPp`0S @@D 04<  800R8p000`10C  \ 4 吀 䀅U/ 6 -L@"@p1 M`0✐(PP Zێ>`10Ub @T@X \1S0000ꔀ !05A1PPL0 8 040 0 , 0  0@ @07 @@K*8K r+r< *(`PFS0 S@OX10X10@0 <6|&&4822#0@00S  -L,0K@0 KMp P`0S  qP,0 bPZ!#`PF0 S@OX10X10@0ꜳ2#0@00S  -LM, P0 004 80 @"0 ,0 40 R*,0SbB0 0bS|0u<000, 0000`!><0 R 0@`J 0 04@& #z@ f80@@P0i,0S?@? R ,@0T00S& @0P 0@ 0 `! B`!R  L1SoS00R ,9L1S4!M?R0. , &)0S& @0 0@ 0 `! B`!R  L1SoS00R `L1S4!M?R@0 (48(2467T22@2p222$#0@00@<`1S[400S8 G?8C? 80A/0008  -L(@KP` K M0  0 0pP  `V -L,@KPp`00KM0P  pW  -LP@TUQpM`0PZ  00P 0P -LP@ XM@:@>$D0P Z@ ,:@3$ R0  ꬷ2862<6  -80L|%P $= 0u%P 686ȷ2<62 - M0`<0/L,0 p0   00P0@,0p @Lp w00RPPU ?p08#8?W@ᅌ 0S ̊(, ,0R #48к2@nẊ(, ,0R # $p - M0<0L40 0`8` 4@, 0  0 0 @<@  @ % @<  yQ y!0 004828 400R80 0l 08 2 0,@@$@0 `P5  $0 00o48H2 -pEM0L( PPK,! ``P((ȋIOKċPp 0@ K@0 X 0S0 #0 0=0@ `x0 p2P 5D#0pw  R@@0E ?`00 0<@4A 41 c 0 0 0R0 0R 0S @tX @0 D @YpH5 "0 >5@ t 0!0001 0R 000 j0 1`Vk 0Q0 0Rv 0@p0!0 D0P 5p=pP @, 0<`@ 000L@P  p@00T( ,!p00@ 0֊,0 D_`4482H2'2(22222TV (,!u`P0 R P 4$PV` -@M `LPpU1@ $L0bd^  KQ Rd000lSd]P p1 [ d@@ V0$ 00@ 0bSL 1  aR< 0TT(2@h`K 0pK0P.=[+ k $K0 Q0$B! 0Rc 0 Q0$B 0R\D ׎P 0L077482᜝P0  00ZU 2: SR -L@40  ( 0@ @00482 -\LQ 0)$D6 -L0@ Y -L@M `0  @@ [0D #PQ+\0PS0#P\ @0dpKP0 0`K0Pu U P P  0 PL 4802D6P57 0-L P@P 0 PL 07 -L@PM p`0   @0dK0D0 @D K0@pKp`K`(P?[S  P?[S0  0048D2 -L@P`M p0   @0dK0H0 y@H K8#8@pKp`K`PP?[S  P?[S0  0048\2 -L@PM p`0   @00D0 )$K<@D KpK0@`K`DP?[S  KP?[S0  0048t2 p-LP `@@0  4 @0N0 @Hp482 -L M< P8 M pp!0 `@@ 0.0SN 0S8 0@ @#0 < `A @0@@D 0 0 @  fx`v0S84p o0 8 @0 40K8P< H0 L ҝ< <482Ƚ22@62 27 -@ `LPp1  @@  Q 00  \ڴ 0@ @ 00paU 2x : S 0 00c C!0 @,pP:Z ]48(2D27 0-L@P\0  P @0t-Pq P0 L 048p27 -L`PM p0  p @0O0 #0@SKP<0S 0@ @<^<4K0L0 q 尋  @B/KL0K@pKp`K`@P?[S ;[  4822x,@@ 0  00Ծ2 -LPM p`@p0  d 0@ @@@00  00$ 2: S 04827 00c C! 0@ < -L@pM`P,  ^0  000  0 @ @@@0V# 2: S= 0S @pP5 PP@`_\  0@ @ 0 482@20S 00ᶚV  (,& , 0@@08X 2Z0 2: S DW V  -L D,M : ! R0  l2D6 -0LmP .D6t2 -0L D6 -0L D6 0-L0P <0 P@ᗆ(, ,0R #0@ᇆӄ(, ,0R #0 -L0@8 p 0 <A0' -LP` Kp@M p 0  0@S &0 0-L@KPMP  0@S 00 -Lp`PMX@0 L 0,0 (` $P ,K s"P0 4822 p-L@`MdP0 Xv 00(0 \ `  $ (KN"@0 c482,2p -LM0 @\0`40 4pK`P0 TM 00,0 (p $` ,K &"@0 ;48@2T2 -0M\L< 8 4 <@K0PKT pPp TKl`0 `0 00 PLKD !@0 48h22 -L0M4 0 p\080 8@K,PKP L PKd`0 X0 00HK P0C@  0!@0 4822 M-LM0 \` V  1R   0\ K 0K@ Ġ 00 |PK@K0Ḡ T 0 ˃ ̠ Ȑ 00 P @ ` K@KxP0 h0 0尐 0 h!@0 (| 0 J24822 M-LM0 \` V ,1R   㱤\Kp Ƞ  00 > 叄|PK@K0Ḡ T 0 n0 Ƞ P @ ` 0 00 K@K`P0 x0 .0` 0 B  !@0 0T 0 J24822 -L(M8 \0D0 0@0  < DPK4@K pp0H L0 LKd`0 X0 00 @<  p @0 48(2@2 -LP(MK 32> #03 0   !$0   xꄓ82 0--? 0LSPf@P Uvd{N{0$}00H0S 02 -L@MP`ؠ!0p h 4@ 0 V,  \@T <1R 0 (@ ]t@S(` 80 0S<<\P+ 4K ~@P0 dntot t 3kt @-=?0 R' Q 0 Lu0S <p$0 $iꄓ82JT2<2`222$<=?0 R @ -L`PpM@؀\0  QD >P 4P 4K0p 0,  (0 0`Cꄓ82$ -LpM< @`Pؠ|0  )d P$# 8@ 4 U0  \@T $0R  W,@ ꄓ82JT2,P T p8K<0 @Pk 0-L@PP P0-0P 0Nz0 -XL, -L@XP D0X0 -Lp`@80P P$P 0S P 0S 0S H X`T0P 0T0 0D H0 <2`' `' -L@၏KMt~Kf0鄓82\2 -L@ M, 0!m?`2.0 2~00 33>40 0   !PP > @00@ 00At  0 0000,0( 0\D r0@0eLl {H,dyp @P0!0 40 #030   !57J52 e' p-@7LP` %0S0 # 傿P0 'y0S Q Q0 LiDf\p p鄓8222 2 -LQ @f'Hf'Xf'Pf'Xf' A$ =$L2x2 -L0   -L 0  -L`XV M, "0 V| 0,$,!$#,  0X20P4B!^ !AӆK0 0bS1!pPU- 00 S&3, S"X 0S   0R  R 0Q 00 P P1! !ѲrPUVb !0 孾p& PPW ps LDL8#D"L$,$80$Ġ @@z 0,0 T3T0 \\ `000D0 P]-0 h , 0@S u0 282 57866(2D2<6 0lP0< <@000HL 0P0@S000, ! !>86 5 -LMA0 0|("#/T0!^ !AKpW `?:h 00bS40]-0 h 0, a 'M?@,a,qQ ;1#,a`PQ@( 0  00 pP[ 00 0/ /p! ! хꄓ8P27l2750ν! ! ѽ2 -L@T0  HⶽQ 4h 00bS030]=00h0鄓827 -L@P X0  L◽P0@ @0P00@Su0 l鄓82<67 -L@P P0S $0  sP00CP0鄓82 -LH!M0` 4b0!!^ !A8K0 R0p APT 0l0@T0S5! ! 00S( 30 |-0APT 0 TP 80l00@T0Sꄓ82 5$26<6@2l22 -|!L0 hd `q QU 80080PU R 1 ` PU0 P0S80 0l 0bS`0 ռ008  1 @T 0S Ƽ 00 0  00C0PU R08 @S0ڻ- ]-0 0 鄓826<672286 -` LR"M?@l00! !ф0x0#lp0x00!2< 3  P 03   00!^"u "0 h!0S 00?001 1!10pđG0AS 00!00! RQ@00cS00 D/ q) Qq0 8a/, !0 0("#!@ 01R 0 (0S 0S0S`0 l0R L0 R l0S, 00PL#㿰(+"64502882T57776`2272H5 -L`@!^ !AK1@p T 3R ` G'PP帻$ y1`P 00S00@'`P ៻ |0!^ !AtK@'! !с 566252X52p'@245 -LH1!^ !AOK$ pR 0BS06a0`_P 00S0&T# P0 P>M?@dP0S BP00!3.2> 03 0   00!! ! 566p2\52H52 0-L@P0   1S %t 0 @t@Q 10cS Q 10cSQ01AP0鄓82 67 -1LS  01(0Q Q 0Q 6 -LM, p\!0 0Dh 00}  0P岺 `VK l!0 00  -0 0 P0噺1 S/ P0R 0R0 0R 0R0  0R-0- S R\ ,0S 00 !ꄓ8D2 6|2`V -L@ql` !0P QiX 1S 0 E0-0 Hox010 6u~1S 010PS S00 0S S00P 6 鄓82282 -L`pP0!^ !AہKP U@!80080UV 1VT0! !Ӂ -L,M, p00 `"0 P000 h00 00X0PP}0庹@!^ !AK <@ H 4 P|0P@8@ 0|048VvP$48 wU` 3,  0쁄q1  @P00)PUꄓ8X222'2x x0R0 <l;}<0! !2 -LP@pM`0 P }0 |HPu@P 0 -0 8`4`ܸP0H00\ 0kꄓ8282d2 -LP@Mt0  P00 0<h0崸 HP 0}0vPꄓ8p2 -LP@M0  P00 0|h0匸`!^ !AbK P ! !iꄓ82 0-LP0  a|0@T+ l 0R 000R0 0R 808R0  0R-0- S R\ &0@T-0鄓82 62 -PaLd!0 T@!^ !AK)1S G)H`l@tpP 0 |! !  vP|| a0 Xٷ01L1 -4 zP Fꄓ8,2L2h222 \' -PpL!0` 崷0 宷0P@T 0  ᡷ 0RpPP@TT0 `剷0S1@S`&01鄓822 62 2p -L`1@pT 1   ^ 0RrpPP@TTU Q0 00!^ !AK@T 1   3 0RGpPP@TT X@0 00! !XT 0! !~p 682 - PL0` Q! @T! | 0p0 1 Ѷ1S j@T | 00lS@T q 0`鄓8 6,27P2 -LpPT`U 0 S  0RoPP! 0 0 PUPP@ i@0 0 P00   -L`p@TPT 0S 0RsoPP 00H`@T p-L@`P\ U 80080 U V 0V0 0% @\p -L@PpM `(@ ^5 1S 8#",$( ,"(#@P 0S 809PX@ (K P(00H0x0d@72T \ - 0 L Ե 0鄓82<8 -L`P@Me 0T0Z\T0KWpK L KH00 3pP h33PU -LpP1!^ !AyK\1 @ `TC U0S0S0S  P ~P  P ! ! Ѫy0S0S0S 0S 0l 00H`@TX! ! тy567 -LPH!0`@ 8 x,!!^ !ANyK0p0CS000SP  00 0HQ PP @0@ "x F0l 1@ T T  @T@7! !&y鄓8357 36<3 -$0 L@ (鄓83 -L@40 @ ( P 鄓833 -L 0@P 00 @ $0l0h鄓803 -L P@` M`pP  $ 0(0 000 H0,0 Be00K@ @K 0@8`  @PP ð굆3P 0-L@MH0  <Ɒ KPP0S ⥰ꄓ833800800 0-L@M<0  0␰ KPP⇰ꄓ833800800 p-L@0M2K(K`0 BK`#<<$0 PP <8 0@5@P 0E0 0$35p -L  -LPpM,$,8#$!l0  LDL8#D"L <4<,4.<@,8@K&,&400&80@ l)PP )PP/ꄓ803X3J5<4<("4!<0P<4<("4!<0P <4<("4!<0 $0PS0000c 0 p0 -L< 4 < 4,<4<!4 ̃ 0   ȯ鄓8d3 -0L # -`L(PPP 2 0b$P HF(PZ0S0s0Rq0qr 000 S rqsRqp8 0s00s 80`0  PU`P`V u!vU! P,$,8#$', <4<("4!<,$,08#$.,  -LP<4<("4!<0 @ Mb000  00 R\`p -0S`1`10 @0X< 4 <( "4,<0'P 00 S rsR8 0s00s 80`0  PU`P`V u!vU!   <4<("4(<,$,08#$., (88 -LM0 `,$,!$#L00cTᝮ@ a00`P t @0, K  Ġ̌.Č#;'`P\p 0,$,!$#< S  q  1a$`P H9'`P9h=?0# 0,0 - <4<("4!<0,$,8#$!,@_00<4<!4 <  BSQ,0  80 3h 30O8 P Z000  bBQ -L@P N? bB! R -L@M0`,$,!$#L00`bT@ a00`@Pn  P<4<("4!<0, K<4<,4.;&`P\p 0,$,!$#< S 4 㷭  1`$`P H&`P5ag=?0# 0,0 - <4<("4!<0,$,8#$!,@_00<4<!4 <  BSQ,0  8800O8 @P 3h 3Z00<4<("4!<000 00c( CQ< 4 <"4,<0 -LM0 `,$,!$#L00aT0@ Q`00`P |  @<4<("4!<0, K <4<,4.;&`P\p 0,$,!$#< S    1`$`P H%`P9f=?0# 0,0 - <4<("4!<0,$,8#$!,@_00<4<!4 <  BSQ,0  80 3h 30O8 P Z000  bBQ -LM0`,$,!$#L00aTኬ@ _00`P_  @( K;%`P\p 0,$,!$#< S 4 f  1_$`P H.%`P5f=?0# 0,0 - <4<("4!<0,$,8#$!,@_00<4<!4 <  BSQ(0  8800O8 P  3h 300 00cCQ -L@` pMr`\e0h0P<4<("4!L00``T@ _00P@P# $ K;$@P 0,$,!$#< S L ȫ  0^$@P H$@P 3h 3<4<("4!<0 00cCQ< 4 <( "4,<0 p-LP@`<4<("4!<0 ^000@ @0  N0 0cC1S0pp8 p-LP@`<4<("4!<0 ^000@ 00N/00cC10Spp 0-L@P  K;ML$P  00cCQ< 4 <( "4,<00 0-LP@ ;0$P <4<("4!<0 0 0cCP<4<("4!< 000 -Lp0`P,$,!$#L00c_T|@ ^00PP  00cCQ< 4 <( "4,< 0 3 -0L cAR -N0L cAQ -0c Lp -L p-L@P`<4<("4!<0 ]0 @00P\p}0S<0<00 0P 0 0c 0p0pp8(8 -L`0p,$,!$#L00^Tp^@ ]00``P0,$,!$#X ?^`Pc@X< 4 <( "4,<,$,08#$$L#`P ,0T0-0,$,8#$!,@_0<4<!4 <  BS0?S (00O  3 -L@Pp<4<("4!<0 ]0 `00P\0S0000 }0S|0|00 0P 0SH0H000 <4<("4!<0  b p 8(8 -L@P`<4<("4!<0 \0 p00P\0S\0\000 }0S<0<00 0P 0 0c 0p08(8 p-L@P`<4<("4!<0 \0 @00P P 0 0c 0p0pp p-LP@`<4<("4!<0 j\000@  00c 0p0pp -L@P 00c 0p0 p-L`P<4<("4 L00]Th @ +\00PQ 0,$,!$#, pp 3 -LP 1<35 -p 0MPL` 0<0 U㜀 U ! 00 0 P8P< 0O 00 0 P'P 0O0E\*8`K p0 !R h da 0P PP0O E\:t 3x 3| 3 -L\ 0 01 P  0- 0@PD0LP S@0 0R DP* @010CS0P0C 00 C RP1Q0P:00P !000!qr005 p-PL0`V*0AT  R <20C2x0`V:  p 3 -L`p@PPM 0`@TQ =\, P ,00,0 E` P,P3 0S0 ,KAa,0 R)-1` P,P 0S ,K-a,0 pR`\`P,P 0S ,K a,0 R  3 3 3 30z`@P`: #:p1 3 -LP 啧 3 -LP @p`PK  $10P? 0 [gP Wp1u@P. P "00 0D0<04@00 L H,(0 2| x0x 002` 00$ X00'pP( 8?+w5 37A55H53 -;0 $ L00 -0 PL`0q!W,u@P) PPR00Lp;H0 R 0=?0,1(00S0=?0<1,0H 0D0<0@0 g 1S vAp67 -<0 00LP !20C2vp6 -L 0P ( 1S 0Q  P p-L@0 QPYUps`Pp (!YQ01Q((`Php 0-L@P\(0 ^ \0 0\00=?0$! 4 8#Q("( 1(0 Q0 p-L<0QGGP0GATڽl z( a01VD z 0T0C0@Dt (0!R @p3 -L P S -L Q%! -L@Q-? $ 0`\9A;Ax 0\ES5P1P Q0 19 0 <0 R  - 00  0 01100L -0L S :0 0 S:d0 0 S:@0 0 S:$001! 055 - 0L   0#0 p-L`TP!@P p0 |! <1` 0 ,(t0$ 8< 4 0D00L 00 0pop5t675 -L0@cT @^T -L`p01W@1@!P 00? 0 0 3R  [^ @'pd`Wژ0W@1@!PP P00 0 0 3R  ZPpd`W  @  -LP`p0V@1@! ? 0 0 3R Y\ `dPVpd V@1 @! 0 0 3R  YP`dPVp -LP@`T pV0@pGT p-LD@D`T P0@`6Tp -L;P*L<@p<0T p``@ !00C0!T( !00b0!zt655 -L@`1!^ !AMlKT pHPu  < S <0U EP@(0ATTT xAP 0! !.l6(3A -L`Q0?SPUMx ^Kjx1 S8''T'''''''''T''U  TK {X0@0 KH3 D3D <3L H 0#!^ !AkKx1 S 0"T0 0"P0 0<0 P \PpWP0p 0W0`V0 T! !h0 ,0bPc U PU0036 -L`D0DPpU! @ PP  0 0 0Q p0l <04 ~00xD0U7 - 0LS 0c0 -L`QpĀ0 0S18P@P U 'Tt q 000,!80$0( , 4`00  l6567 -L@P`pQ41 W 1!^ !A^gKU J@t @&  @ < S@ <0T DPP(0QUh s40W@A'P @0G! ! 9g56P3 p-L ^NP|@8#h P(0\*p\<0^ 77S40SAP p6 -LP!U`p!*0$@T0S"080   0  0 0  d 0S S \:Y L 0  !0   $!00`000    000L\*7 p-`M(@LT( 0S" $  0(PP(U(0S 00 0P0 R 000,000@Tp 0-L@(0!XS $ \ !0 S0S0 @\0Q0 0-L@(0!XS $ \ !0 S0S0 @\0Q0 -LP00pS  0S(@T *p`p`峖@T4 080b066 p-LP@R,M  R'=?0 @ 03QD`K#$0!K40 ,0-00 ? 0, 03Q R p -L@T`hMP T PTNLK(DR},@ L 040 !, 0H0  D 0<0 1 8 !^ !AeKT 0t!00 0(0 d!000 ( X1 @! !њe=?0 ( 03QLK R\ ;T7P0V1@K@Q<0VF pPP(0QU IIP@Gr0h0 ` 40X0  CP 566?6  -L⊟Kp WGpM@l2 P(0X *P<0W 774`SPDQIPp  T T T/  V@ P  I?PPp40?\*$ 1004\: 0 0 3R  QPP P V@P  =?0 0 03Q  R\ P P0 RaP 0PPqP\$0 P0Q P  0PQ0P 0POK@Q0D2 <" 4042 l"uP BPZ0?S5$ 0DS/x'p'''''P'P% !P ! P!P670!P S*0 \R  0 R00P0 0?KY 7 0-LPU@xM9S  S1=?0 @ 03Q`K R\\0 0 4[1KX0=?0 , 03QK Q\ 8[ 0 8[1K8[ 0 P F?( ,  bR(0P6 8 0R*0-? $ 0Q 0Q 16 0<0Q U U  001![<++01 0 0670 -L`pPPM$ E$K$0`S>8'8'''''''''''''''''''$ 0$$ 06h@!^ !A_cK$ 01`! !gc6 -L@=?0P%>P T@@U0P RX3 -L`4p0P@P U O ZI?0PP 0 0-? P20PB0000@@ -LP㊟K0%Md2 R`2 @h2 0?S\" 3\ Q\"@Ra{P  -? 003Q  P^ P80<0 cp \p(0 qPW p"PE8 0RP Y*40 S*0 `2 0`2 d2R0d2 h2R0Qh2 :h Pd"h IP`2S P2SX2 X0s3X 0X2 X2S 0SX2S Kh2 <PP`X X2\"l@@ nPPl  0!R5(PU:;#;S @T:P @DT*,0S , ,0(0g00 0j0 h d6h6`6 -LM, "fP0k 1 @PQ0S `jP`%&:00 8pwP`v, `0, S'''CR@(0AT$ i1$ 1 lR(* 0P00Q (p W 0P U P!+"+%UR !GH1!1!PEu(`00$000  ,, 80, S'''CR@ 56p3`6T6(0ATLL Gi0010000 00, ep3 -Lp`LQPP @t00S(@$p 0D` -@( $L -L`Vp. "Ơ#1 W!0 0S V@tPPU,0  p=p?0l @P4P0Ph0<  ', V8 H D` GH,91_PD, 5`6T6X667d3 -LP@p`0M!^ !A#\KT JhPu  ,  0p{%< S! <0U EP@(0AT<< oh0S :AP 6p3.0! ! [ p-P@L0!^ !A[KT`, DP C (0!RT3hLr ! ![`p6p36 -L`V0?SpZM K1S񟗠(P((((((((((((((X@K$H0T0 `#`3L P P3X ZH   Z+=?0 $ 03QQ10l T0P h0 L0d `0 H0-\0 ? 0 03QlK hH Px2@TWPKGP"L"0C0 0@"|0 08"0 00"x0 0("t0 0p0 =?0  03Q 7H\ .T*80<0!PcU @KTGp!0UP(0QU 1 S 1@   0V0g 1 @ 8 0R@*@T` @IP <[,)") ,K<K.K)[0.K0 0-0 ? 00 03QBK G P 80<0#0cS[ -? 19 0<0Qv 80<@0 cPP(0QU@ !9S90S@ 8 0R@*@TW1 S: :8#81N80<0"cP 2!^ !AZKp 0CPP(0QU ! !$Z&!9S90S@ 8 0R@*@T  0S   ,! !ZI:1 80<0X!0cS ZB_K  Z1=?0 T 03QWK G\X1T!40 0 TU=?0 0 03QcK G\ @8U40 'U0 WU @RK@T X0!^ !AYK( , pb0CPP666(0Q@U 1  8 0R@*@T-? $0@Q 0Q 16 0<0Qp 40A001"[<++01080! !_YlpKL bMD0(  P`U Re !000!0T0!^ !A"YK5 (0PT0! !)Y6W@tP$@Q 40(00 , 2[";;*02 D @ @< W 7d3P63! !X 0-LP0@ 0S00|a0,0  <0P@Q@(0AT@@ 3e80 0 = ?0l @056p37 -L@P$M<0 \/ 80<"00cS% p\ :#:S   ~p00@0   0ID0 0D0 L80<@Ÿ0 cP(0PePP 8`K L1P !00000!0( @T 0S d !000!0T0!^ !A:XK4 (0@T0! !AXNVPuB0PS>  Pu``V1M?@,00!^ !AXK 04 @0HD0ᙽ,0 0! ! XrPP<0 P666d353VP  !000C000 R  !R . Cdu(3 -L|40  <0P@Q@(0AT88 $d00 0 = ?0l @6p37 -L ,@KDMK<1 ( PU Rd !000!0T0!^ !AxWK3@tph`!^ !AfWK@P.Y! !oW|U0T0! !bWoUd3P63 -L40  <0P@Q@(0ATS| c=?0l h 0@ 0C 0S4 1: S ,@v Pr r -6p37x3 p-L=?0,P`0!^ !AVK\ , d0 @R006AS  aT0! !Vp5 -L -LPpM$W#*;( '#;A, YT `Pr <CC,0, SCP(0U4 d1, Q/ TT c*`P$+`PK ,0, S'''CR(0U 0, Q  b00C0000,+<0"+(?0 @A1= 1c2c> TP   @!000 !066p3R5( -M40 `0L bP"vT0!^ !A+VK (<0RBP@6(0AT[H b@ <0`#0"&"A@ 0R0, Q 00000CS00ST (0!q0@MR5(6l6 -L@ 5 -L@v0S0 -Lp@MW Q 0S4S,0 ' (KP# `<0R砡砱B^@(0AT`P 1  0 0S0W ($pd66t6x6000$ Q*( 00K0,0KNP P 0000C00 00 0p6h6 -LK$K(9(|9(p -LP<K a M=?0@0 0pD0 >4@KDKtኂ"00  !0S C 0R@  B 0 000 D @XP00!TTV}gE#t p00 -L < S"21  6 -L ,R Q 2<0 0020 006 p-P@L( (\,4 0R0!1R,,00S(L`V%  0LP TP0,0T 40T 4 040,0 0 000Q 0  0 X#`t}p -L` M< 040 pQ, P0D 壄8 W W0p<0  d]0 ]]"!4!R000 0!0 W@  @ 00!m R l0S0 ST ,K 00K4@K@Q} Q Q,40 DP ,0T ,P,0TP, 40040,0,\,1 #0 A-R9PA(pA(pA(pA(pA(HA(pA(pA(pA(pA(PA(pA(pA(pA(pA(pA(pA(pA(pA(\A(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(pA(@A(1 #2 @0C3@0S00  QR3PP P 00 0,f,00 Q40~37 73,40 HPz , P0,0PP,40H0, @,080(, 40040,0,\,1 #0 A-R9PC(pC(pC(pC(pC(HC(pC(pC(pC(pC(PC(pC(pC(pC(pC(pC(pC(pC(pC(\C(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(pC(@C(1 #2 @0C3@0S00  QR3P  P 00 0,00 40Z kۇ -\1 R 0R0  B 0 000 D 0X`S,0 00!< R, 00!m R l0S,0 p, $,08 ( 0 , ,4,0@, 8,0<,40H0, L,0PP, TP,0QQ, \,@1 ,P#$00B-S90F(PF(PF(PF(PF((F(PF(PF(PF(PF(0F(PF(PF(PF(PF(PF(PF(PF(PF(>T&3 -L0 P 0 p-LP@>M)`R \0 SPR1S1S(1S 1SP1S >U`!0&3p p-L`VpQ X@S 000@`@ Q6p@j8 -LPU@M c p0K =0j0Sf dKC0pS  1P0S X3dK!000S# P !000S PP K1  @j8&3'3 \0R 0S  -L\0 8#Ƞ R 1S\10\ RPn8 -M?@H2LS!RX0p0S =?Pp܊Pp g 4'3 -L S -L S -L] -0LRT -L -LpPP >`I嗮⠒T 0S 0"Q   Q\  \2R 9D2p0@T@00!0S 0S 1  0S ! !wu !suD0 00 0R 0S T!000S PavH@ T !Rx0S 0S  3g /g1St0H2S0H2H@ T ! !01X%! h0S R @h@T0S X'3 5H55@j8h'3 -LP8p@5P$` 0!@! T5 -L' -0LS5 -L`=?0HRpU tP/  ft fVA 1S T  fV f t !01840HQ x x0RHH Q 5 -00LS 騠7 -@$1L(0$1P $1  %1!00%1}t0S  -@$!L0S!(0$1P $1  %1!00%1^t0S 1  0S !Lt -L` S 0\PpU0 0R 0@ _00S U 1\  0 P0 < D5T@5'37 -L SPpM01# RR1 R\Xl1 d1R \1@cP!00S X l0S 1QT`P0@ , Tp!^ !ASFK 0S>1   ,0   , U019# @P`PU -? 00@S 0S orPo8D5T@5'3Z 08  @@! !ѨF7 -L$0!^ !AFK5 -L$0! !шF5 -L  h MH , (PP 1 c P0 AT8 0 D < @P ~㼠` 1T a0 4 S $P0 000X 0 @ S$P< $21SLP L 1 040L W1L0T R$P8 L800L0Xp R$PD t $~2L0P 0S8000SD  01 !LD000!R101((AP0 A40 R0  @ 0S<004 01@0 !D000 1R01 PH NX, 0S) PH # 0S@ <1  H 1S 1S 1S 0H0 (!1011 010, @ H!80S X < R 00S  H  ~} '3 -LP(A`T T pqD0 X0q`pH 00C0T @AD0 X0AN@H 00C0 -DM0\`L V2 2R 2P@"3}PUi  Π !lP 1Rpc1S00l0 W(Q1W\@}IT0!V R 2X0!Q H (\0!Q > PP$ P0!U 2 T0!Q ( X0!Q  `| (1S H|h0S  1S U l! 0Q0R@X  )&=R #yq@t)0R #qq@Z  )&=R #fq@t)0R #^q@T hKM8|+pD5T@5'3'3(3D(3|(3(3(3,)3t)3)3l0S 1@CTAhK0 th|011@CTAhK" @Z|01X@\@ E0Z E0  !1H R H2S U SHH R0S U S00Xf U@*@Ta0S \1U@ 0S 0S 0!@00!T P  0@PR T0S 0!@00!T P  0@PR TT)3)3 5Po8@j8L5T5 -LPMp 1t0 p0 \ P =?0HP >+  P|"0P0;8#d2P\2 ( R 0S R  0P;0 2P8pQ`A10T lK P 1!@0TPpWlE/L0! P@b!!30D2g! HlK@P;l0 \0ll1S1SPd0S @@t0T0l0! 0  -? $1S0<0Q@T  t=?0 R En$00LHn87`n8`o8 *345H5U?0S H2S l  1SH"t0x0 1l p01l1S1S1Sd`0SMhK0H?@ll#N@Q @ ez000l7,*3 -Lr -`\PL0p Ul0 d0R \0@P z00S 0S  D5T@5*3 -L`\P0pU0 0R 0@ yz00S  K?7,P"W )&=R0 <0S1? cRl < 1@0$!D ,1S)&=R0* D5T@5*3 0-L PM= K?0H"R 0 $1S0 <0 R @ 0 0 3R@TKK K045 0 -L-? 0GO03Q  .^  -L@PpM? 0(`K 0 3R /@T G 2P P `1P P `G? K  K0 -0L QQ|0  -? $1S0<0Q00 0 0P 45Po8 0-L P@-? 003QPU 0^ 0;0;00 -L-? 0S x 1R0S H2S  1SQ0 $1S0<0Q X T0H R H2 SHH RH€=?0x t !p45 5 -LP?H2S  0  03\ 10 -L`@tT ]?PH2S S !x0R 0p 0 3R0pWWx0Pq -LP=?0H"R  \=?0 0003S -L@? 04 0 3R -^  0-L @P-? 003Q@T0 p-LP`M?@000 Rk0Sp -L\P`U3 3R 3@#^x00S 1pS1S(q0KHS< 0DS8( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (( (((\   0 \  0 p2P 0DS1갃((((((((((((((((((((((((((((((((P 1X 9=?0 R  0D S񟗖((d(d(((@(P(d(d((((d(d(d(d(d(d(d(((d(d(d(Ԅ((؅((@(((((n    E*,~Eu*zM?@H2S 0S yH U iD5T@5*3(T  =?0 0 3R00h4V/V 1\   0 @0P \   0 0 S -LPP< 0 aS 0S @0H@pT) H2S Vx0S  ]3S 0\05 7Q  40R\0S  ]H@T 5H5 p-@1L  M+P^`. 0!0P!p`1S v΄`!00!V.Y?T1 X! YV΄0`1  !v>/T!0X1\1 \!! pL5 -L@    h0 0S::0\ l9S $1 (v$1 0$1l 0 X5*35 p-@$1L pMQ+P^ ` 0!0P!pL5 0-LP*0@0V01Y/T!X00t9x9`  &=09L L)Y  ;00.))0 T@j8(| _( -L K0M Kl -L -L p-@@0LP p `Pp1Sal0Sp0l0l 0PS0@@0@  1PU! 1PUcpH5(Pn8 p-LPD0 R p1@P P !1RP\pQP p R 0000 R001@T`T0P aX0P a|z1@TbcpPn8H5 0-LP!P `0@ du0 80R0(0@ Tu0D5T@5 0-L@P? 1SQBu1S3ʗ ! j!j(!$1R0$1& $10$1(! i(!i(E)1SE)^ 4S1 c)((0<-3 0-P(ALT 1  0S !iE)0 -L`p(Q@U $1 X ;TC =!^ !A<KY" TK=?0 03Q  * @T T@T `pd  0WP@@T! ! ђ< P 0 -(!LR $1  -@(LP 0S1S  P -L @!1? c 0  003S@ 0-L @P-? 003Q@T 0^ E(E'0 -LP$)t0R \-31T@ -LP,t 0R 0 -30T 0-P(ALT 0S $1  %1!0%1h0 -L@P, (\)  1cP#!Eo`0RY1Ep1S&!hY(1S(1A!  c -!0>00L00 -L`Pp  @TU0|| S 0/PU`eP @ TUPfU00U 00 00\5/3/3 -L p2M@ `0P!^ !AI;K! @ @T 0ST 0S P vPpppW.! ! =;<K 80@/!^ ! A;K @ @T 0STL 0S P vPpppW> @p 0 @ S' P@ 0S P  !00C0! 000T P vP00t5\5/300T P  !00C0! 000! ! :@ 0-@ 0LS$0S! !^ !A:K0PS@QJ1 S2Q ! !ѡ:0?Q\ 0 1 0H00 @ @! !у:0t5Y7\5 p- LPR 0Sp`!^ !AQ:K 0 @ 0E @>S@@ 01 0! !N:pt5Y7 -LP@a0S0@` pR V 0S V0S BPP  ,&AP( T &P5 -0000 L 0 (y& -@(LP  -LpBw`1 Ġ@ (PN@D^0000 0  ` s! 0  00! $0 pG! !00! !!0!w!"!13 - L0"0Z00S  p-L@`&lPPpL0P @ @0@4 40@0 `pp`Z7dZ7pZ7lZ7tZ7hZ7( -L0@T p 0x 10 D`0`V L@R&P /ꄠ-+8Kt@Pg00UVUT0 0S01PP L,0 0P gE#5XZ7\Z70 0SobV8K00gY 0E?Y   -0L0m\Z7 0-L@l0PTS  $PTQ  $808 0, \A00A\055XZ755 -Lp`P@MPd`dKx0 "!zU @U@1@@#=?0 03QdK E$ @T V XZ7 (0@0 0 :g7 p-LR% t2R 0R \2R P2R D2R> 82-? 0 003SP p=?0!@& 0 <0Rp P 0 0 3RPU pxA ; h0PX!b=?0!@& 0 <0R 1 @P 000 3RP 0  003S\ 0 003\ 00RPp0(P0  003S "\ pR@RRR@RXZ755=?0!@& 0 <0R~ P @0  003SP\U ` 0  003S`Vp 0P5@ 0P(!1b$-? 16 0<0Q@ h0  p-? 16 0<0Q- @'ppXZ755 -L@0 0@0? 0   0-LKMPPH@0( 0R 0 00XZ7tZ70 p-d`dPLM@ @@T@@Q@T0 PXZ7X`7p p-L@ T\0P 1`0 ? 0\ 0 3R "\ p0 \ pXZ7X`7 -L`pMPUPK000Sm 0   $ ( ,0@K4(LKD@ @0@0  0{13 -LpM`V00W@@T2P0K@0S&]?P  0  003S0@Q T@ 0  003S B!P    0  003S@Q  -< <000C0,0( 200L4\`7d`7h`7``7(5 -M L 0*00)0莠 0', 00* 0霠0(0 0  0'0ꪠ0)4 0 P0(0pv 0*00) 08 莠@Ÿ 0'`0@0*0霠0(0 0'0ꪠ0)0 0(0pv  0' 0 00  莠  0( 0  靠  0)0  ꫠ  0*0  py  0' 0 ,0  莠 0( 0 40  靠  0)0 80  ꫠ 0*0  py 0' 0#04 莠 0( 0#0雠 0)0# 0ꪠ 0*0#0px 0'0 0# 0莠 0( 0#0雠 0)0#, 0ꪠ 0*8 0#0pxyZn -L,@Kp("h8#XM^( R ,0@0bKS ,0$0l,0l @?2c<0T0( p ,  2b3c!Y7Y7Z7NY7 -LL0L @R 0bKS(,0 @$Z77,Z7(Z7 -L@qdĀMQ `J"`1^T**V(10 S  0`P0 0,%,! @f0 @00Cs 0Cs0p8 -LPqe฀MQ `J"`1^U'*V%10 S  0`P0  0f%%@@@D0t @Dt0p8 -LpaM4 0L@PT @@d@x.0`- , K400K,`4 0Ap0 ZV*0<\ U 0 ` 0pp0P`0Z  RV:U ` 0pZ 0`L\  4P0 4 0p8 p-L@0@`0P S! Dp0p8 -LMAP p@`P   0@.0@ 0R0 Q V1!R 0p8U! 0Q 0#22w00.0V . U1 Q -LPpa@M0#! #  20,à .,0 020,   0 0p8 -LSp/P`1 ` @@1!`H R0 @ @0D0S  -0@ Ep& @0p;#02 SEp @p :#""  Ep w@p :#"" 0!Q 0p8 -L@41P `R  1!^1 0u000 pH R000 0#8#ᰀ 10SPL`,00@+0 |`7`70p8`7`7 -L@ M!P@0 p,00d0C0CS: 0CS*Aq1 `2 Aq0 0001^'@0, 00,0 n e  PE2u#40  0 ,0@0PEu00p8 -ADa M L,Pp00e\00 00e\Aq1 `2 Aq0 0001^'@0, 0  ,0 n e  PE2u#40 0 @0PE0du00p8 0-PA0L$ 0s ,4<, .  0*.:S@ <*"S. 1P0 ,000p8d7 p-0L @TpP0Ah`s 0 001P0 ,0000p8d70p8 p-0L @T"0 R0Q Q l`0 # \0 TU 00S 0ppHn80i8@i80p88 p-`A 1LPP080S P1 00 000 0 ,.#00p0p8 -L@``PW X! TqPjQ <!0@S@`P1 R 0<0S P@T@PIT pa0$@T 0 Q 0  VX T@P  !404  @000!Hn80p8@i8h5`@5p7 -L >P0! R 0p8 p-L` A0 0 PR0 0`01 A?10 000 0 2S0@;w<20""00 0  0p0p8XqАP0 S-`P ` C?00!Q:=0@Ps@D0 @0@ 000 00p8@i8 -LQKM4 pP01 0! 4! P8 0! 8! 04!p81W @!   ,00C00 , PA000 20 000pPA000 20 000p@0H < p,08 00 0 ;8 ,010-*C'!0<0!0<0!0<0p 0 #10P 0 #100#- 0p8@(D( ((33(X((q8 0-LPR@ RR! " @@@0P@ R @0D 1@@00@0 0@Q 0@0,0<0 0 < 00p8(@( -L0pLA0LS Wa0LS>9\@ P@0Da0@00 7 C   @0S-DH0 200L 00 P0 200T 00 X0 200\ 00 0<00 < 0p8@( -L`ܠp@p0P@ @P @0D 1@00@0 0@Q 0@ [U< 0?U000 0   0<00p8D(l( -L;^!@0S0@000N S1` <  @D 0100@ D!000C000p8( p-Lß3` @<0c0F SB(@(@(@(@(d(@(@(@(x(((6p0* DQ H0L 4800Q0  D0S $44220D\\1P  00p@0F5S(|((((<(p(P(((($(8(L(((`((((((((((((((((P(((t(((((((((((((((((((( D0S0CD0 0D0 9 D0S0D0 00D ,; D0S0D0 00D ,# D0S0D0 0,D0  D0S0D0 0,D0 a D0S0D0 00D  D0S0D0 00D  b D0S0CD0 0,0p8@(33 D0S0CD0 H0S0CH0 0HD t 0Do 0D)j 0De 0D` 0D[ 0D RW`T D0S , 010FSD000000=p 0D0S5Se. D0S0D0 H0S0H0 DHP*0Q0@40 H0 80p 0D# 0DXp33q8 -\LX0 @R<0 8R GR  00!0000p8@( -0 L< 0p8@( p-Lh`Pd0A8R<0 2<E02 2< 02  p0p8@( 0-L0 BQ%R3((((((((((((((((((((((((((((((((((((((p0 d0 X0 L0 P A 0 (0<00 \.000p8@( p-L0 Ba%R3(L(L(L(L(L(L(L(L(L(L(L(L(L(L(L(L(L( (L(L(L(L(L(L(L(L(8(L(L(L(L(L(L(L(L(L(,(t0 h0 \0 P0 ` Q 0@T (0<0p  .0p0p8@( -L,M4 8 , 0<0 9@ D 0 P #0SL00YF4@0PP UL@ " 3!^ !Ac!K X#=?0 403Q4 R\ 8 #4 00!# 0pᴒ `2Y0ZH0  q,@$1 8P4P8P 0H@4  5PP@0  0PU T  00(2(2S4T0  T!<0S00 0Pu0pPPuPH!0 R <Q @D0<@ a00 @< 0  , 00C0 0,0  <0  0Y   04 000040!0< S0?S ,0<0 @@@ 0, 0CR 0"# R 000 00D0 &L54385r80p8Hn8 @( 0,0 00D0 0Q|c7 -L-? 003Q00S 00|d7 -XX0X 0LS!0(S0(0p8|d7Hn8 - 0L0d7) -1L pR!@`P |xaQ0<0S  (000,0 `R 00\WPt0\ 0 0 sW t00P0<0S  (0P00 h00S PH0Q 0(0i8Hn80p8@i8d7d7l )7),p8|d7 -L -L p-@0LS- `PTp0  \ 0 qs|00PP@S FP00(P [p0i8Hn843d7\5)7,p80p8 -L6 -x@Lsll0!Q X0 R L0L  0s80 R 0&sd7Hn8@i80i87)\5 -00 LQ 0 0@i80p8h5 -Lp`?W* @ 0  003S0@P!00 0 3R0P@|!00 0 3R0@0 0#  0  003S 00 0  003S 00 0  003S 00`XW$ P` tpx@hP 0 0  0 0 ^ 0 0 j>X5x550p8 -Lo -Li -L@lPh`d`p00 @ 0 0T0 0 50p8x555 -L$MD H2Q `0 H S@K0SC0SL0 0 S 0S(0S pP U*L  0B @-? 003Q@T0S PU:pGW p R 0 S 0!2TÀP S T10,uHP0S 㿡PH j U -? 003Q H  ^ OH0000! D00,00!,0YU0:S01" 00\0S80Q 40R Q  @i80p840 S R RY^ =?0  03QH \ H R ϡ  0-L @0LH0PS01" 00p8 -LR@0! ,0 H0S0  0p8 -L0, 00  0p8 -L0@ M -00!LQ 0s 0p8d7 -L 1R 00R0p8d7 -LQ Pqd -00L $0A~!&80p8 0-LPL@@"0s (0  0 l 0008d5d7 -L -? 003Q  ^ h5 -LB M, `P0 cUX =?0  0 3R P 0  003S0@P T8#P 0  003S0@P T8#xP 0  003S0@P T8#P  0  003S0@P T8#H0  003S 0 8#걀pᵠ@Ṑ0H8# G("x0J80#D 0!H 4  B("(X!0C8#8Wp!Z!T@!07% $&Y7JP    ,0>U0P`TH@ 0R 040Y n))8)x)p hHn80p88d5 Pᐓ 40  QP PJX  P X180 2  PSp "4@p0@ *P+ `X  P#X10 2 |Ÿ4p0 @ `@@`pDD$" W5B4 0P @MP HPPU#z P``r P40@ P.P )P@T [ Pp0s  j 1 0Z A Wo  b0 g0@0W0Z 0 j 0 a6  j\0 0L@p`PP  lP 3d50p8h58d7D630pP WP@0`T00@t04 S  `SPV P 00`( 0@T0 0c0d7d70p8d7 -Lp`0$M]?PDP @KH0 9 L0 ^HK8@KpL0Hp 0S) \ 0S$00! C0@gTgE#d7d7@ 0p0S 0SL08KH00 - LE5 0-LH$XUV0 U*$ P?M0$I$ ?E?B0 -L{0 -L0 p-LPQ``M$0$ P 0 1d7d7Hn80|0 R )R \ \!0 0S@@T K 0P [ Hn8q85p -L(@`00Sp B007P0p :T00""0@WS X |00nlR0h"0P  !H2H"  P000!TV$"W000 2 R W1! 0WX`0  0S !!0 00Tm0 PUw0S 0 A <1Q= 1 |P4!00 #AT&  TU0PX 0S5 U0P 0"AT0 U 00WX0@005d7d7585P5 p8`@5p7d76o8d7755Ho8 65 -L@0 BR $1 R0 d7d7Ho8 -L@#=C\- \!p RX1 \!pT!X1T!@MCP^p` 0!0P!P@4P  !000  @000!5d7d5P5`@5p7 -L@#B 0pS6 0܀`S P\!RX1 \!PT!X1T!0S@MP^ 0!0P!P  !404  `000!5d7d5P5`@5p7 -L [0O00 L5 -D@0LS ^00 Z0   Sd75 -80 LR ( 0 #100#') d75 -80 LR ( 0 #100') d75 -0LP o8 -80 LR (0P $1 d7d7 -(0 L P5 -80 LR ( 0 #100#') d75 -X0X X@L<P  !,0,  @000!Dn8`5P5`@5p7 -0 L@BP|p|`@D0T t>@4P @P  !,0,  `000!Hn8`5P5`@5p7 -0 L@P|p|`@0T ?T@P @P  !,0,  `000!Hn8`5P5`@5p7 -LP- \1p SX0\1  T1XpT1@MP^l` 0!0P!L@P  !,0,  @000!d7d5P5`@5p7 -L -L -L8 -L 00d7 -,@LP 0 x3P00To8$p8 -0LX 0d7Hn8 -L -L` -L P ,0   BRP 055 -LPL73 0-L@ 0P0S ! 0S @00d7d7 -L0P5 -L@0Sd7 0-L0 0@ \ *Pd 1S0S  \: T T000d766 -L H@H0 P  !(0(  @000!P5`5`@5p7 -L0P 6 0-L@RH1 P 41 R(1 00 2T/4)4)5)5)5)D5)$5),5)45)<5)`5)`5)`5)`5)`5)4)4)0$00G!080 T0  05d7\5X5 -L 0 0 t5`5 0-L1  1R@P=P ^ 0 #10') ^ 0Q0A0 0000S 0 00 00^ 0S T0@p 80  RA000d7Ho85d75 -L 0 Q㜠1`S pPp@l!03 0 *"B4 SS0S0   \ZQd7Ho8d76 -L@ ,0 @ PNK5 -L  P  0@ 0s#05 -L $0 R 0 0#0d75 0-L@P@0T\0 RP 00#00, 0#1S0 00#00d75 6 -0Ld5 -L0 h0(( 080H@?P  !(0(  @000!e7h5`@5p7 -LQP@0D1  0  080q8e7 p-T1TL P! `\01 "\!0 0 0 0  0 0 0 @R 0s 0 R0!x0 p0!  jX 0T @+@00S pHn8q8e7e7d75d7d75d5Lo8 -LL@0H 0P  !(0(  @000!h5d7`@5p7 -L`@`X0PH@pT ,0S l 0U0R0S9l0`0H@T 5 -LpßBP`^ W 00rI0GEP񟗚?)?)?)?)?)?)?)?)?)?)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)@)?)@)@)?)@)@)@)?)@)>)?)?)@)?)t?)@)>)HF@@0Q  R 0S  2: S1 01Q  00 R 0S K P LHD0 @. 0 H H L;3D;3,;3T;3\;3_ h;3l;3߻Gh;3p p- L00`@PPPT <P @T@T /P0#4 y@T GpTn8\5|;3 -@1LS EP 0S  -L@ 0!!909 -L@(P $1  %1!0%1X< -L0!) ;S )Pb:b ! 0-LP@xP: !0X 0ESEF)F)E)F)F)LF)1 091  P! p099;:0 P9  0 P . 09;*0; S b  P0 09 0l0 09S 0C 0L 0E 0P0909p0<3V6 -L`@PPMxPl V`!PVP`#=?0 03QlK \ V PlKUpE*00CS)H)I) H)H)H)LH)1 Ʉ1 19;*  9S' 0 00 Ʉ˄9;9S 0CV61   0A 00 909PU:t0S  0l 0-@1L P  X 0 U100S ^p@%p90900V6 -@9L+`S !0Vp> 0Vp: 0 0!)9 a*"*0b9!>S% 0!)9 a*"*0b9!9 /p9)09 )11  p9+S 0@!9W` 2 _V00   X0!90C9!! 0z   9 \p9)09 )WRa V/9[Q ɔ` V0P 0 1 0 PP0!Q9S099S;p9S0C99S/!0P 1   p pp9S0C90 1   p pp9S0C9 W˔[ P 9 /p9)09 )V6 -9L)c ;S Q -LPp`M9 SY 9- @0!)9*b cZZ Z P)Sɖpj   b:lZZ) ɆE9) 009 )!W  R 00 QXO)W)Y)Y)`Z)9P   !9"S )P9)0:#:9 )!$10S0; S40 P  0  H2 00P  J0p  0U0U>0   R  /p9)09 )9!09 0 )t1RpR+9R9;!0U100S  !9S )P9)0:#:9 )! !9 S )P9)0:#:9 )! UJ0p;  P U0@ P0  0U0U{V6 0 0U 0U 0U P +1J pL 0U 0U 0U 0   0U" 0   )J 0p  /p9)09 )1   ^pp0U(3 0S"K /p9)09 )H ]J9pT 9<0J)$JT U 0HP )d2Rpm  0 j 00!N@ 1   11 @ *! 0' #11 1! 0   1  1!! 0 !0  N@1! 0 N@11+  !9090090 0S D0v9090 -L@ P 㩟09 0-LPP09S t0PsP  0 ~X@I3 9090p7 -LP@K4ßDMP0  L =T ?0D0 ` `H )HK8@K9S@T0 2 QQ H2S!Rp0S PpJPp 'hd@X \ 9!d $!0 10X R\0  S 2)&=R 1X R 1X \0X Sd d0 \ 1X T0  >0!^ !ASpK R >0!^ !ASWK R x` H ` E0`0 B ` ? 8K9EOP0& l h@ %%0%1L L 0  003SP00CP0 !00L `X i0 bRRڼ4[0i 0c09 ;S  gE#=3L=3 9 S R1TPdP T0 0Shdt3d h L$1 Q100S 0L0 000 3R P00CP0 90< P0S 9S  9 !90:)#:9 B)!0\0^0S L0L0 000 3RP00CP0 ^ ;0CS;0;sP0Sp 9SlpLKPK0!)JbP0T@T@!!T # )L 0 0 3R  p@g !90:)#:9 d)!L0P 0L0  dP 0!)Jb0T@T@! !T# ) 0 0 3R V @` !90:)#:9 d) !0 00 d 0SPpL0X 0iS\0dP 0d0 P0S $1 (1%!R L0 S h>0! !ۗ 8K79lS80X  L 00 R P0` S h hP ` -L`p@K1$MM?@D@ L  H0 HK8K1 LP  0 # R t1R ጽP aTVTN8Ke700-? 0S ᚾP(1S 1S=1 $ 1@! 0  003S'P P`FV  PP`Vt0S   0lPP``V 0 2gE# 8K00-7L UE  -L`@> 0PUSp Ut  !0S9 ;S  Q9 SS R$1A`` (1%C Q`1 ` 0P`Q 0S 0S4 00$0 |A?P -L`P<K0 MM?@@@  D0 ;DK4K|0pS% N 6Va@00-? 0S|P K1`P0S  006gE# 0-LP@R=0 0 0  0 0   0 0   0Q 0 00 00S000P0>3 p-LP$M@T0S 0  03\!$0  `"P0@1S 1S @>TP01S 1S>T0Z E>PEP@Pa1PPF !1!`000!9Z^ E>QfgcZU d1 R`VU00!00@P00!00!UB?U=U@`P01S 1S 0 T 0 T @>T\0P PE1S 1S40 U @0 UU Hn80q8P5`5`@5p7@i88Z 0  003S @@S 0  003S0 8# 0  003S0` !Z 0  003S @@* 0  003S0 8# 0  003S0 8# 0  003S0` 8# 0  003S0` `8#x 0  003S 0` d8#h  0  003S 0 P8#X3@@W Z ? Z f7 VU X - X & WT,3@W$3p  >0BZ4 , 1(2  $"  0,2 !(" 0$2 ! " <2 "KR (Z% k"noK 0K 0 3R \ T 4T8Z 10  2 " 02  K" q00! @@1 " 02  K" `P0V0`V` 0 0 3R \ Z 0,2 (QK0C2 =@P 0 0 3RK \EZ,2SoK\ @P  0 0 3R \ Z GbZ Ln88Hn8lKZn @ 0%nK 0 3R w@T h1x0 0K 0 3R` _\Q 0 10 3Q D0T 0TZ0 0T"6 T2 /0 $1S0 <0 R l 00X0 $1S0 <0 R 0 0Hn8fK45p8 -L@K pp M=?0D0 `\0PH0 T8@KLHK'p@0X 0@DS"Hn8gE#5 8K'00 0-Lhd @ 0P@ 000 @ 0 @ @ 0@ @   0 0@i8q8 p-0 @LP1`h1 RP 1V P##pHn8Dn8@i85 p-L @0PT 0 RP l 01`\  P0!@p0!Q pHn8p8@i8 0-P3L@L0@@DxP0(0!3 00Hn80p8 -Lp`P@T T T Po P`VVU 0` -L0M40 0<0 0, 00 4"80 0!^ !AK00! D 1@ 0eH PH I@ P P < PERPHP <D 0l0P P!P0  UZ#\1R !L p' @  +< M@ 0dPGW <?X `m JL@ TL  @ @ `0PESW<0S0P00 < P0P<0 U P Zpc0SPEPL`L < P  W P *P85Hn8r80p8pGU=?0X0 &`F?`L T @ @  d`0P  PET@ TT  @ @ `U00!X  0, 0 3R P [P00!UA,<H 00, <  H 0g00 0\ 8<`VA4H /\ P00!(! !#85 -L8M80 @0 04 #0P <0 0!^ !AK00!D X3 @ P0H@0 `P <z`FT ä/R40dH \!\4 4P UZ#00!=?0 0003Q  `00!V PUH\ `<GTLL"0dL UP1D pR2@ P ` 0fp40HU0@`@ 0e\0 T X PEL @ L  ` V@ ` pUz40HT0@`@ 0e\0 T X *KU*K , KL0L PE0pU00W0S@PpG?@ `U=@ P  PEL @ L p`P  V@ z`/ 0fp85Hn8r80p8 LPE0`L  V@ ^` pUU L  @ \0TX`@P40 H Q0   a \ R 80H`80O00!(! !85 -3L @P  -L -Lx0Qt a@PU ;zPP )@0F P*0S@ŗ@TT5 -0 L,u7T5 -L \:1 R $0 P  ,u7 -LP`DpP 1@TT  `P>U0p8 -L-? 0P 03Q   00PT5 -L-? 0Pp 03Q @@ HpH`0  0S0@TT50p8Hn8 0-L-? 0dP 03Q @@ 000 @Tڀ0T5 0-L-? 0`P 03Q  00@ 0#0@\0T5 - L0pW00`㈀QU @P y@Ty01`V`PAP yP`V(v7 -D0!1@LT 00CS0y0p8 -LM, PH 1 !p W00WQ< 0R8`P@@TP1S P Q P TX 1`PVU U00V0S X 000,0! pp My0p8>Y -LMpA!(`"VP x`P 0| 0SZ(3@QU x0PS 1  ^?00ᵠ0 *00 p-0a!@LT 0S pT  @R  yxPPT 000 pa00!P$0T  p0p8(v7 -L2M 1<0 !, 4 `00 S, R 40S00 pPv< 010 80 40 \ QU @ 0d!S  8 @ YpP@@@08#?TXZ8 4 !40Q000, 0A8#8"S,0  @ 0!0 $(4"('P0 `, 0A8#80 $S,0 <4P 4 000<084!r8Ox 0p8(v7<4 {Z0 -ɑ@P 0 00 H00H0T0 0 0 `0R 0`0t z0 0ሯ.00 8 000 8  P00P0U3U3), [,K 0,@K@00@0 h00h00,K \:8  0L04 Q4 E00,V3`V3 -` P@L`!00p\ @ \ @T p@ p 0 0Spp0 0" 00W @00' -L ,0`  ! 0d 0d0`0  ` l 00l0!00 -pM5 L`<S3 x0, S1 @ 0S p0 `P/   0!^Z0 Rڡ!0 10@T@ ,@ ,00 0,@`00 0Q0 005 0  x0S 0V30 0 -L@0!! -@`0LS h0S `0 y 0 0D 00))) -`` @ !00H0I00 0 0 00  00C0L0 P 0 00pp0C00 00Q PU , !00 "Y0"00 00?  0C0 0C 0V3 -L 000 $ !40 &00W3 -L0z7 -,0L  00bS 07z7 p-L`RO@gPP<lpT V R?00`0p\3 -L`@PPp@P`0 SS aḗPV 7h V bƬ - 0L\38) - ,0L@pw C -L D0ASX -@ w d00dd00\\01TT0 1L0505L80hX0*$05)Գ,,)@,,, -0Ls00s0 <0R0 0 0S$0 0S)  0S( 0-L@C%zP P)P0 SSP,P֞PPP70\3 -L@ u, -LPt0p``S, @PPt0S  !t00Ct0t R  !R ᭏t0S  !t00Ct0t R  !R ᙏ0S 00 0Ϭp0l0r0` 00 ` 00  -L` -8<L00 l0C0C80<0 4 0$0 0 4;#440 8 <@008 <04 -8L<0000 8 <0.040 - 8 0<0L004080<00000 -L8K `p@ M0PKF WV P0@K0 0? 0 1 0p W`V080 < p0PK!0pW0`3 p-L`0@S ;:0;8 ;;0;2 ;;0;, ;<0;& ;<0; 7;07 7<07 7<07 7;0 7<0 7<077 h3 p-L@P02d a"Bi02d "0C2"0020 "aP I" 20 @0,0@`0(0@ ' @0"0@(  =0C0  @Pd0C0@@\p8hj3 -L00S -0L00SP* 0R6@ P | P h P T P @ P , P 銄tj3j3j3j3j3j3 -T L0@S@0 R 200((0$ S "z7z7k3j3k3 -L0S  @00! 0 !0 0S L| 0 0 L| 0 3 -L0S  @00! 0 !0 0S L| 000 L|0  p-L`P@$!0S0 p p-L`P@$!0S0 p -L0P0` !@  epP \0S  \p 0 0p቉! -L` p@P0! R ,0S`p 00 0-!$k37 -0L00S 0 -LP`P@Mr0 0 SS 2@ 0!KNPU$6 0-@0"LPR 0  剿0$ th0  aR L00 4000000\k37&*xk3 p-@$0 L`P 1  aR 0ap 00 @PU#00CS(*(*(*(*(*x ph`X HD00p7'*k3k3k3k3k3k3 l3 l34l3Ll3\l3ll3 0-@1LS 0P2S R1S 0000 -@0LS ,0S0S 000S  -`pL  !0Q S00S 2S  00垾0$0  B0Ό!PP@NPU0( R!0 00y0 ( 00rD0D 0Ό2S !7&*'* -L p-`0L@ 0 cS 0H@0S0$0P%  0 bS0H@0S0$0P  0 0 0 0 0 P0!\0S  0\0 0 0 00Շ!LP ! !qp -L`PpM0,0 00! 0Ad b  ^ @ Y  U  Q  M  xI  lE  `A \\A = ; 0Spn08 P  0. 0 S`) @ %  0T @       0S Q0S: @ 0P@# 0 0   pl3l3l3l3l3l3l3l3l3l3l3ll3l3 m3,m3$m3 m38m3Lm3`m3tm3m3X0  0 0 Q (  ,0! m3m3 0-P@M0LS@C0 S TT  @bTKT0 -L@`p (T 0PU 0b0CS 0$0  0S$00$0$0 S \0@ $0 R0 S1010 $00$0 0S  $ 00S00$ R R 000S0$0c 000$00$0 p-L@` P/00( R0002S 0 P0$ `p 0-P0$ L0H  !1Q00S 0S @00 #@0$  @dm0$  @Dt0 @S0  0 )0m3 0-@ L0 02  S  PU 40S   P0m3 -L@p`P&0$    !0$ 0P 00eS! 0$ !P`0$  RP U 7m3m3 -LH@T! 0bS1          T 0S 0O s    <0   $0  ? 3* -PM`0Lp8#+R#(O@I|  Z(@ 0,S0S S^?:0 0^P0  ,0 = 00@T070S@2S  $K00 0P  $-0S 0b0CSL"0S  H   R 0n3 n3Hn3ln30 -0L Q 7 -L`  !00 @  0R Q "00aST Q  R 0aS R 0 0 0bSl0S @\T' 0S$ 0S! T P 2 Pa^p0S  0 0`0cS000bS)ʀ\T,PP  R U 0bSP 0QU \0 E0bS0P0@S 4 00(^g~P 2P U ( R 2S 000P @00 l0S  0X0 0P u00!@00!X 0P wT@0S= 7n3n3 -L <2 !PP47 -LX -LP0!pq(`V0Ss `p @T @j0S00z 0S P !00 0'!00p0  !0S 50S 00$ P 0S 0? 0S 00 00$ d{`H 00a0000!V`!n3o374o3Ho3ho3 -LpᜀM@00 S$0 @R` 0llPP0 d0C0bS LL0H 00P\ 0@0Tz77z7o3to3k3 -LP`0!pW 0S ! @T!0S 00$ P!0S0000'0S 00!00!L 0P0a0 0S00!o37o3 -L  \@ 2 2^  P 12P0  όQ8 -L@`ļc0 0 -(M0LBP PKL `H 00KD0 p@0 0 p00? -L?Ÿ M0`` @@P@00l2 @  ` @@@00`0 ,Ÿ?sp` @@@00 0`e`0 0@@`?0 0U` @@@00 0`H` @@@00`dd1d    6` @@@00,,1,!, &` @@@00 0``E F?@0@0 0` ` F?@ 0@0 0`` @@G_P X0`\p3T* hp3#xp3p3T*p3p3"p3 &0T*p3p3p3p3 -L`pdMPUPK4Q '@KY@P ` p Y p-L`xPK@`MFb0X0 0@ Hp -L =?0  -0LPMz7 -LP`PM e  Pb pP P 0UP =?0 0003S 3? 6@K3U !U{ 1U) 0CU4 UA 1U U 1U 0UM }1U: 0U% v1U 0CU0CUg*`1U hT1U0CU]*0C81UX 1CUU YV 0 SS=?0 0 3R00P N  0003Q00P  0003P.$0 R 0 003\3?00!   )`1ik@V 0 SS=?0 0 3R 00P   0  003S 00P   0  003S00P 0 003\F3?00!  >Vg 0 SSc=?0 0 3R00P   0003Q00P   0003Q00PC 0 003\3?00!  Q =?0 03QO3 ?00!F-? 1 0<0 P w t3? o^)k -? 0U̠ 03Q \ U=?0 03Q  0 00 100 <ꌠK⨀ =?0!P 0 <0 R 18 0 <0 R V m@ 0 0 3RK ᑶP0[S 4#OP  K ȳ[ [0[P [[0[ oP[ [0[[ 0R0Y0S 02S  0 0 3R  lP X _O =?0P!@K& 0 <0Rs 18 0 <0 Rh 0 0 3RK \  0 0 3R ,\   =?0!P& 0 <0R6 0  0 3RK \ dKp]-? 16 0<0Q O 4K-? 16 0<0Q < R0 0V-0S0 0#100+100&-? 16 0<0Q  P  { \  0` -L P0S$ -LR Q |\"48<#80P 0 S  SP 0S S 0P0P 0S\ 00\ -L -0L -L -L -L00C0 -L -L -L -L -L0 - 0LS0 00S000S|000Sp000Sd00 0SX0 0$0SL0$0,0S@0,000S400040S(040e*e* f*8f*Lf*lf*|f*f*f*f* -Lp M, 0 40 2 `S_P@0S ,P 0 0 S 00 S40X 8^N`VZ p-LP`@00!R   0S0S !p`w!020S 0 02S 00 S 0#1  00@A0 008 p$6 p-L@`  !0S0 R 0P !p8P!p$6 -D0L R R R0 08 -D0LS S 0 R R0S 008 -LM :  KF% -L0ML@PQ r@$@080D 0CH0L -0T0( 0s`pĀ0, PPKX ,PPK`p㌀!X0P2X00d02 h 0t0 @Pp 0L0 D D !>$0 ,@ H  $ P `r* %6<%6%6r*%6 f,  0-PL0@S S 0 PR R0S |0 W,Q $ P ,r00L0<%6 -LpGK@@FM M,]/0寏K4 己R?K,0 2 K 1KH 0D0K` H@K $PP`  $PP `  0$PP2x0"0 00`F /K$PP0D0KT 3HP h0`  s$PP  l$PZ  ?Ke$PS^0 0x4[ t4ÂQA(0 , X4[ T$6p0l0 R3[S- K0R0 0 00H0 @ 8 00S040,- 0C@00 <"$P0<6S  R-4 0 ,0@0$P_ 0 GK@@]/Q `  #PP  #P `  #PPqGK@@]#PT u.` L #PPb`F d #PP[`=?0 ` VP P 40 SP@P P $RP0 z604@ a 00kx0xP 4l+@hl@.1 10N @D@P000 Yt38u3t3@u3, ' 0-@P0LS x00,$0e#&,0 a#',L ]#0000 -L P " P P 0 P  P! * P '000" 0000v0@000 ,$*# 0@00R 00S+,d #7 -LAq 4"40A q4"40 -L Q 0x Q6 S0x ?S 0@8S3`7cR: H `@AR:40,0 ȁ `R:x? -`0$ L0S 0  /鮠0 Z@ @P U P! ePᅃHp R0S $(0H ,0(0$H @0pe,p0eS@00WZ/ 0w3u* -P0$ L P0@0PS` , 01;,0S00 S 0S. p$p(0H ,0(0,H @0`A,`0CS@0 Vڝ0H@S %  /,0 Fw3Hv*x3 -M0L,`@p0H@Wp!gSS      !,00gS,0!"@00gS@0P0,@TP@ 04@04 H !@ ,0p x3H04H0!X p-@0 `L$P ,P PR  ,0S 0P pX/p,0SP,@T@0@cT px*Hx3 -0$ L @R00 0 00Xx3 -0$ L0@S 0/  $z*hx3 -0$ L0 @R ||x3 -LpM0`(P000,  0@ 0 `0 &d`0 &d`&4 0  @᤼P0 @`ᔼ0 0 0 00 0S /p0 S$ 0;00dSY0 S$00 : $K  0`P 0!S $H0S00!0S 0P` ,ˬ/07P @0!`s!&l/&0H@S   u*x3x3x3x*Hv* n0x3 -L@M0 0Sᚊ0  0 P 000 0-PM0L @Tn0  @0@fP 0000 -L 0-L0@$B @R0@ M0 p-@P0000Lc /P x` 0ࣻ0@00`p -0Lc - L 001   "$  A @  $ 000 !1@ 00Q ^ 0S ΅ 80xQ $@$z*z*y*x3 - 009L S0 0R 000 -L M 0  0-L@PM0 00P0 0-L@PM0 00P0 -L@p`P\ "L Q@MfPP0 00x3x3 -LP@`M, Pp_@T` 0 0"@V@e@i TT0 y3 @,  00 -LP@`M, Pp_@T` 0 0@V@e@i TT0 y3 @,  00 -LP`M0`#1p|@Kt0 `00u0S 0-L@PwP 0UP00000!0 -`$M0R2pppL 000 ,  , 0@0 0pp00 , 0?0 0pp00  0 ppp00  0vT1  0^ p00?b ppp00\\1\!\  R p,,1,!(A  @1 0p;00 , T,pp0 0p0  0 0pp>0 l 0 Dy3Py3\y3hy3!py3*|y3 %T*y3cb0e8y3ed7y3gf7y3 -Lq -L@P&U 0 UP"3S 000pP0T 2 (!0 2,  >P0S 0S 0S000 0006 6S 6S S7S 60n p000S 0S S00 00d0`V :0 \ P    ] 4F?0 0ÁR2S K 0FD ^0S ^0R0ą0Sw0 v0S 000&0R@000WDy3Yy3U!y3z3z3 -LP`p ^P 100CS 0@T PE0P  @P%6%6z3Tz3 -L -LPp` p@0U?00 Pe003cP0S00a|3 -L` pPM80 ;@P0R 70S W?00 |3|3wS8900``@U U UU UWX 0S0?S`w0S`V , K00K4K,000 [ 40[0(0Z (0 8 c |3|3 -P0L( R 0($  0, | 0F@0$@X0  0@$ 8#X0p`}o00fSʑ0倠0$ R00!p C` `00!N"0S0  1S?01X `"`2QQ T2Q p6@( ^. Z V%0Po ]0 X00C0#4p`W3@*̐******ؐ*PP PpP`0S Pp0@00 0(000 p!0 00P 0#20SP 0000 00z02S 0$ 0 !37BM 3NEFXPiD3\3h3p3x33333333333 -L@` p(0PS 00S\0( p0`0WP 0(00 $0 室ዸ 00SP0  43 -L@0p` W00 R0S n2S  00d0  Q 0  2S P 00O0$ @R 0W00SJ PP PUW2020S- 0($ )0  $0$ 0P$ 0 0>C0C0eS 0$  0>C0C0eSKPU0p$ 0$ P0 2S P 000$ T373 p-PL 6 o02S 0  0$0 `N@0S0$  $00S DG<Dp4A!Pp鬀37Ԁ333 p-P@RL` P  P P P P P  P$ (PQ  Pp頭5 -@L$ 0S ?00f02>Q  ?0\ Q  ?0TQ  ?0LQ  ?0DQ  ?0<Q  ?h04 Q  ?H0,$Q  ?(0$(Q  ?0頭5 -`M2L@0S2S2"WP p M_P@0  00} ^NpWRq00!pM_P@0/EP@P x6☫P   0S0 S0800 C S=83\3D33 3000 2 "02R2")^NpW(0S 2 0 PN@ ( 00匢( 00l$0  00cS !pP@0 0"R 020SNpWꈁ37 -Lp`@PT  R 0R S 000 0T 0 00R P3 -0 LX g<* -L0` M$0   !0pA0S/ 0 00R2"S "2S $ K2 2S 0 00R$ K2 2S 0 00R$ KOpW$@TP?P٥``@@ @@@@p0$P(0$00S 00S P?"0<R" #P $0SA@!;8<*@*P0 p0P@`0 0S @ 0 0@iNpW0S 0  !` (0000$ R 00/ $0  3333 3 -L`PM2!.Y 1r 0k?P Df? 3ql ^?Z?p V?R?W @"1p1l0@"T1 q * 0pp  l@0T:@ T*.@0 T0 1:(1  `0@0 0@0C 01$0?( ?(0,S W ,P Y 0S 0 R@P TR.*PpP0" 20S00l1"hK0R "R 0]8773$673@>  2 P = ~^@ T: p-L@0@ 0PU7202p_P 0 2)`P "$hP22 Ap01"01 "p0 @0`*202p03$6H370e8<*l3 -L0@KM]P`pᔀ/"001PUP@1S 7OPUP@1S OPU0S0088%6 -D0 L 0@D0S  000WCV6 p-LQ#^`( KM*P@ \\V6 0?^:003p -LM, 4 -4@? 00  0<0Q 18 0<0Q Z , 0,0Z0,0  0  < 40S! 00"0@0 QK   !  !00nS  !0SP 0S@Z,Pl 8@ p@P 0@DPS RSA{Ay`r@DP`T NPV00V0SW00Y  R `A\@Dt 0:S DAT`@DP`T )PVV VBT 0  1 T P@T 0 40S Y V V V 가T4  R4 e <0! 0 8<0!@V67l333383܅3 @< !@8 꼅33 -L`pP<@ቪePP0 00 3 -L 00@V6 -L`Px@pT 0S X \P @TfhPP0 0083 -L`pP"@R2괪**Ī*̪*Ԫ*ܪ****** ***$*,*4*              ePP0 00$3,34383@3H3P3X3`3h3p3x33333333 -L@p`P\ "R 2 /L ϩ@˩fPP0 00鸆3 3 -L^ 0010nP0 00P0 00 -0M0L0  S0 -LP`M, P Pp_@d` 0 0t@Ve0li PP0 꼆3Ć3 ,  00 -LM, H`0 OP,K8  p @DP P  4P0C @0@0 $0P P0 tPh0`PV0 hb PP0 Ȇ33333 3,383<3Ć3 0 0, 0 -L(M?!P L0  0 <0P R c Z pZ 0  P`ZJ HKpV P`V 0:S0:SC@aT@T  ۤV00@6 1p`FPV -PV 0  $ V P`V 0 L@P P0S 02 LjVPPP V6x@3 -LPp@`TXg 0 @_gPP0 00 3h3 -L|MP`p@ 0>L 0@6@fhPP0 p3300 -L`pP@X\ 60S6@ ePP0 00$33 -L@p`P\LD fPP0 00 33 -L@ ?!& 0 <0R  P -Lp` P R(*********************************h@d@`@\@X@᪣fPP0 00騇3333ȇ3 p-L@PTU` 0S  P 4`00080 < 0Sp 0-L@PTU 0S 0S0 -LhKMP@DMl 0P% 0S"lP`  U l 8 0Ha B/ 80 P ~NY%6$63%6 p-LPMO`0P S 8400b_00N`VZp%6%6 p-Ll0`O@P2 2S D0P , WO_`Vp8%6P&6 p-LX0`O@P2S 0Y,0 02O_`VZp8P&6%6 0-LD<@P ,P P 04P800(3%6,3* -L 43(3 -LM K k -L@ 1pP`0PU  ΢PU48PP 1  0 0 0$0 0 P(p ,P 0pPt0 !@@`T 0S(P84 @T0P&6&6&6&63 0-L@P00@P  ~PP0 0S00090(0,0d Q @P0"1@ R 0S R0Q0&6&6&6 p-L`D0M@PT $0 (  ٥0@PTf&63p -0LS -0L0S   0b0 0 -0S    b0L R R000 c  0 p-L`@PT @T!^p 0-@ PLU00 0 0S =?0 R 000 -L$0@A000&6 -LQ Q Q 00000H 0, 040 0 00  7 -LM @BK 00 $ K / P 90 !̉3 -L!`M2P@0PU `PU4~7PP S  0 0 (0,00 P@@ @T 0U 0RT 0$062[,K(P 8c8 88,0 pP 8 O   00 0B7@P p @0 0@@(P P &6&63&63 p-L0P@@` @T P 0RTpP 0 pV@ @T L0T $@T TT ( 㘠G2424$0L0pp&6 p-L1 P!@`0 `0S@ ᫠P0 @QTp 00C 0 ,0S P  0S`0S R 00 0R 0S00 7 007p&6&6 p-00L0`PSp0 2A 0 p00z6P pPPP40 0 \0 2p&6&6~ -00 L0RS\0"\ |0R0 0000\0 00 0R RS 006&6&6~ -L00` P\R\P0"Uq x0R PM?@ "0S  0@  0@3T&6&6~ 0-L00@ P\0R 000\0"\ 0R 0 0S -PC P? 003 Q 0\U !0&6&6~ -L0 0 RP\@X0"T @0R^q  z:PA&6&6~ -LM0@XQ3#0#Z2Q12 -? 1 0<0Q[ 1 =?0  03Q ``2S =?0  03Q ```p\ =?0  03QK  ᎜2T ,2T 2T 0CT| 0T "X2T 0T @2T 42Tt ,2TC  2T 2Td 2T2 1T7 1T= 1T 1T1 1T 0CT 1T 1T 0CT 0T 1T t1T h1T! KpK3pKpKpKKp?K2 "KK p?K2 Kg/Kp" pKpKpG pf p&6?&6d?dP@ ddd dd d d ddPd dd d @d(>dPdddf pu pp2S -? 16 0<0Q K_pZKpUKpPK0K2 VpIKKcpDKp?Kp:-? 16 0<0Q K`'K K `K*`1  -? $1S0<0QmKA``0W0V0SP 0G>SK***************************************************************` ` ``<`%`45`2S =?0  03Q K  -L0 -0 L -0 L -0 L  -0 L( -L @ 00H'6 -L @ 00H'6 -Lp@MV73PV(p I 004\EJ?D1H1`0张 V 0S `V1SQ0V00 0S (@KD ሠmQX ,<'68T'6X'63 p-LP`@T @Tp -L`P M 08\ 1S `V5p0S (@K G[ <0pS <X0<013<0S@@*30@0C\ 0 1\00C0X'63T'6 -L@D P0pT 0`0S@0@TT'68 0-@0LS PH00P20S0 -L =?0 V p-L@40040 PdP`PSTLQP 2TU\SP 2\P 0$ $0 0 L 1T'6'6 -L0@0P0 Q*@0!Q 1<0S 0T'68 -LP \ T 0S !X0S 0  0 <0S 0Q8 -L@Q0 04 Q <Q1 Q110   0C00! 0 000 0000 0000@ 0<08 -LP 0 Q ! \ -LP $0 R ! \ -LP@P M !0S !q0a$K.$ 000460$%  40:040i  0000S0S  3R#Y*\Q 0!0A@ 0\ 0AT: 07 04 $0 0 K 2! [0@ 0!  0@00$0 0 K 2!0[ 7700 Q8$0 0 0 0@ 00 -LP 0R ! 00\ -LP D0R !0S0 0P\ p-L`P !0S !p!0A0!04\ Pp0p0    000` 000  Z0  p; S 0R 0000  0FP pSpQ8 -LP 0R !0  0 000 0000 0000  0@00#\ -LPp`4"HM0@U* 2!0 `px@0S 00CS0 4`K5@p`V0008 0-L@P 0S,!00,0 0Q0\!0 0, 0R 0 0R8 0R< 0R 000M R G0Q8 -LP 0S,!0,0 00\!0 0 H 0R ` 0R d0 CRd 000` 0 厠Q8 p-L@P 0R0, `P!p000 40,1400  ' ,02 ,0 p\5 -LPM #0S ! P3a4  00\!01 p 0R 0R @00>P00  00  0 0 0 00 00 00 0< 000`00303PP ( $ 0  2!0 0$ 3S0?008  0  000 H00@005!0s'@^@Dt 0  2!0` 0  2!0S 0  2!0 F 0   2!,5@K@05K9 2!,0@,Ġ5K/ 0   2!0@0<6K@@D6@K0, PpL0@0x3K 0S 4PK3Kh0  R R Q8@'60030Kl0 0  04K  B, n000@PU000,  ,  -L@PPM !0S !O1 a4H ,0 DTA 0\!01 7$00S 0 )pp0 P0S p P oQ8,000,  ,  -LpP`PM 0S !B0 A4; 0\!01 10S(pW\ %0  3S(0W#000yP Q80H0pd `p d 000,  ,  -LPM\ T"0S !@2 q4 0`0S 0000   0   00C sQ 0L  iQ`4 < `V6V X 11L!0 @` 0 0 0  0 000 P7,0 6,0   0100 0000 0000  0@00 0 000C0 P 40,640  @Q8\ p-L`P 0S !p 0A40p@P p @040P  40@040< @8 D`WpQ8 0-LP l 0S !0 T0A400P  4004000Q8 -LP L 0S ! 4040 Q8 p-LP l 0S !p0T Q4  ^`P@0!q!ppQ8 -LPM 0S !"0t A4 0!40040!K?0 P40040Q8! p-L`P x 0S !p(0 p 40PU0 0e40 @E@%@@< 8PUpQ 0-L@P 0S  P 0 S 0\1S0\0l 0S \1S\40!$0Qt3x33T3333 -L@ MBPl++x++++++++++++++++++ +,+++8+++D+P+\+t+++++++++++++++++++++(++4++@+L+X+d+p+|+++++++ 6jQ~{xXurofli'fc`] K00WTSQ&N K00HEBG?<96!3 Kp00-*' $L!0Qj 4 }0 0-L@P (0 XP F  X0 -LP@`Hp5P TO  (1 R000 PI0 0  XTP%40%( %<0, 0@T0X P 00 0T0c0 0  TX 0@0 0Q  0@T0 Q 0P T0 0\'6 -L`P@HpPL01 R000 `I0 0  jXU`&40&( &<0. 0PU0 ` 00 0U0c0 0 J UX 0@0 0Q 0PU 0 X0 0Q 0` U0 0\'6 -LPp`M 0 LP00CP0H0X< K0@XmTpLq 0S`'6 0  0L0CP0*0X<$K0@XO0TLq $0R p-@L 0 L0  00CP0  XT0I0 P0H(` 0U*X@0, RP`:0Xvp`'6 0-LP(0 @0?T0`'6 -`M@L(LpW%T@$P@LP `Lp pL00 00# P k ++`'6|33L0   00CP0墲X -@L0LS I0H 0I0(0 L X嵲0L0X0鼭5 -L@MTŔP\ P%0R $UC  b>5n pLU? p` W> RU/0S$0 R W  )V  0-?W U>R*!>U P 0᳠ L1 0L1 V -LP5~AML1`VUIK@\>!0 P @`L1pVLVV 0-LPP 0S !0l 0ATP $0T50  S $PT 0P5 弈0 0Q8 -L@`P 0S !0 4   0 000 <<040 3S0Pp00uP00nP PPpdQ8 -LP M0p" $@K@0 #`$0[S00, 0 0 00" B 20 6 0 0,$ 0$@K `0040  0  0@$0[S#0[S"Kd jP `  0@$0[S#0[S"K VP 갖3 -L@P M "0S !2 q4  0P`'0K'0[S  0(K(0[SP(0K(0[S kPP 0 (K` p(0[ CSR R R Rb0CSY+T+T++T+T+T+T+T+T+T+T+T+T+4+d+T+H+  000   000 3+000 0 0  !  0  0S  0)K) [0 020  010 00000   0S (0[S ' [0PZbZ 00( [ '0[0Q8 -LPM 4 0S ! 0 Q*Q80 @S0  0  S0!  -p@00L 0S`_ Px!20 !  00S0++ +,+8+++D+00&00#00 00d00@T! 100C 10  @T 0 @T P Q@<13" @0T00 P$0U0SJ3\3 -L0S 1 00C00000@ -0LS0 @ 0-@00L 1R@0 ^ P00 !0^0 -L`Pp@P@UP0AP 0 R0\\0\ P @T0SY PU@ -LM0@  0\0 * 0   00@ -0 M L 0  -L00C\  00P00 \ -0LS0 00@ -L0S0 @ -0LS@0\0  L 0\0 -@L0P <0#a0R@@0\ p0 ʌ 0\10@ 0 S\ \0 00 0c \ 1# 0 0b0 -L ^@MK00, p000S7: ^  100 a, 100& P ^ 0 cRL0琑200}S00 ~S00J3\3QS0000pW -L@pTP`X @T 100C  !10 00&1`X @T 100C  !10 00aV @T HH100C 0 !10 00J3\3 -L@pT`M 00  0# B@T=000 0R"0Q0!X, 0, P00 ,  \0 00 ,T  0 \10 \ 0T  0 \10P0X -L@PPM P00 ⢑0`0, 90Z5 p `  \P !0 QbQP !0Qr,0S QP !0QŒ 404 0 40 0Z -LP00 \ 0 40 -L@0?000 P@  000 \( 0 0000  0000@ 0000 000000 \ `0  LP@00Sp ( ?P0(0W H 4P0H00 h Ph0p0x00  P00 A/rP1`@P P P #`P 0 1 0C11\$! !0410 \1$! C/P  \ 0 $ \ 00lp1 0-L0@0PC\  @00C30  B" 00C30 @ B" T00C30\@0 -LM0 S00  0000  00   0  0@ -L0\ 0\0@00 R \ P00 R -L0 S 00  00  @ -0LQ@00CFSx4&+&+&+&+&+X&+&+&+&+&+&+&+&+&+&+@&+L&+L&+&+&+d&+p&+4&+|&+|&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+O,COeq~F(Gf p-LP8@K0`M4K80 { PN?K0 " K0!0K P Yp -Lp`PPeM 0S !_H@Kp0D0K H OPQ40[oOKS  P  P  P  P @ P pW0*0S(0 Q4[$ AH0A7SRo00mS0000S P X00Q0S *0'  Q00 p-L@P`0C@T 00CS* R 0S  P `00 pp p -L`p@T1 0 S( PU%R :S0@0@0g0j0PS0b0 `P P 00e0 0 b 0``@T -LM, 4 8  B00 Y:0)rz ` 0VP*8  RPPU *` P,0P V8 U  8 80S P35PU* P@0 P 00P V 4Pd E40@fP040 @ Y`V:,04 (R40 c꼭5,383h'6H3L3 -Lh0` PR T 00S0@0@pT  0kP@Td'6'6h'6 -LM`,0 V* h0 0 0@ T@1@T:0 0R4P spP @,0 t'65X` 0Vt'6 -LM, pW4 h0YS*Q' Q$, 0 @T@1@T:0 0Rh` 0 .PP00 ,0@ Xp WYh'65 - L R 00CS* P P\fPLPP@ @0pU,`0@TPh'6T'68 - L Q:R0SS P P,3P St'6 -L -LP d 0S !0S S S Q p-T0TPL `R @w R R @n Rph'6t'6 -LP$@Tp``l0S2+2+2+82+d  0 0 0 0=?0 R l@pcW DPH< 8X W,.! ̨3̙3 - 00 L - 00 0L 0 -L`M@P 0S ,P 000  00 L040 (0(0 $P80K q< D08P$0S3+3+3+3+lJSJ  0r<P'4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+4+0 0 00087000@@0< 8`!gl p-L@`$Ml!c!`1Aa"#2b1Q\>6"(1 "1X !c!0Aa"#2b1Q\3%0 "1X00S000  "0 x0 "h0 |0!00n00 0 Œ4pL33 @3Mbz7 -L@ (㾭P04@80ܝ33L+ -"rL M0 `B2, "2  0PŸ@ @pŸ@ n0, TPŸP@" Q 0  $2Q000 020Q00 0 00Q 00a 0000  @ 0 @2H!0 \!PX1 @0  @@ 0@400!00P @0  0@  P P P P(P(P(, Pb3z743@3P3,383H3X3`333333Ğ3О3h3ܞ333 3$343@3P3`3p33333 p-L4M @ 0 660㾢PP+`0"cPP``0"ZP P`@0"QP$$ 괫533 3(3L3p -L+f-c.`0  鴫5 -@0LS x0 !;0#0   : 0  < 0 ! !0010 0000 00 000 -0LS*00 -PLPP% `0! 02Rp@ R !R @ TT@H@ !0@@@4@!鴫5`333 p- M0000L 00`0P00a d0~( @"@呇@`d0e"㊇@`L0f"デ@`40g"|vSC343H3d3p -Ld㖇e㓇f㐇g㍇ 070 -@0LS w1 !10#0  0 000!5 0 ! 5 0 ! !4 0 " !20# 0 " 20# 0@ # 10# 0   0 000!6 0 ! 6 0 ! 4 0 "!3 0#0  "  !0@030 -0LS S b00c00 0-1!L1@P P7 02S R !R  @0 T0((00SP xU ` `0@  0R  `0 0!02S R !R  0(  0 0R RH00 00|3333 -,0LP 0@ yT{7 -LM :  K -L -L0M!PPY !vKOP$@L 00T0( 0s䐟䀟䠟0V X`KX VX`K⸐ᴀ㰠!X0Q2X00d0 t "0| 40x00t0000@X 0T0 P P04@  L0 !>,0 \ P g+(6 n+{7@(6'6pY+ fdl+,m+[<[@ 0^0P0Q )\)\$0[WS"0[WS p00 R)\0 p3`(6X*6 -L  0Q0 R p 00  Q 0 SSd*6p*6 -x0L S 0 @0 0A00p 0 0\C40餥3 -d 0LS R1S R p10 R((6X*6 p-@40L S @ 080R 0CD0 L 080 D 00SP0`0H0-<%00 ,0<0P P Upp-,0 p -L 'M" " ?K,0 2H 1 K20K"`,p" 匀0D0KPH@K P}P Pv P oOK0Pl1x0!0 00PE/KP^ 0D0K H 2 h0}P  wPD3( K0<#2 (0K " 0D0K H P dP9O_K ]P< 0VP5![R2 ;1[S/ S  0R@@TN?K < M?K @ @@ 1 " S1 S030#2 0 @000 S4 H +P  P \ - U.PL P@ Rd0| 0d02"S.R000+Pd PP0!$000 0 ,!00CS0(0孿(P 奿PPtPPP 卿0 1Q2AS" R R01L0 R10110 P@Ƞ (63303(6(6@P@x10S "Rs  0P  |` (10`000M1` 0Zw0@00! 0  10  .@ ($ $ 1  1 t (0phh@dppP`` T  @T$(6t3m+p+|333ئ33'633333, g -@0L S 0001  O) ,$ &,0 ',L 000 p-L@ PP1 P" P s P&  P? m P9 j000e ,`sP ,0 /sh1:S0P!0000J0@000D 0S ,`asP ,0  s,$10@000+ +,d 0S$ i,@LsP,0 8sP @sP 0!44 0800 P00!Sp7'6A5p7 -L0 0p>#> R0Z -Lp@+0bP 2p000 R000Z P B0R#20p p-L@)"+8`P 2p000 R000Z <<P R0Zp -00 0L 0C0 -L @ 0( 0R0 0001  @ 0 < -L@K/M 00S 000@\\0$#hP H᡽A @G:40P`P  0P@PT:0 a P0Z:L @!@ $@ @T3x343į33H3 ᵠ꠯3 -LpW00X0S`MZJ 0kPP C Q 0@Pް10S@װ*00 0$  0@PHP*Q*?0 R |3300P*Q:@00 -LP0M0\0 @PLYH1 R=?0  ` @` a@Dt p0p@T Tw7 r200 \ K@T Tc#h ^@PP U}0N@P r3p7 3\33ر3( >c003 -Lp00`  : 05P P P "P P  P P xph` X P3L3(3H3T3t333ش333L3h3333ܵ333(3 -@|Lt0tp Q d\ޮTۮLخDծ<Ү0ή<3L3L3H3l333̶33 3,3 -@xL⻮l0lh Q \屮T宮L嫮D娮< 0壮,堮L3L3h3H333Է333X3 p-PM L R h`h0R`\`\(@KP偮L }@z0 ( (0  L3H3|333и33H3D3X XeP0!`D]<Z0 S (T QL33P3|33Ĺ33p -L`pPR  @P  <0P 1) 3 -L@&#  $(|,t4 l8d<\@TDLLDP343P3l333Ⱥ333383T3p333Ļ3 -L)<M0("( d  0 0 $ -!M000L 0d  0 0  -("(M !00L 0d  0 #0  -("(M !00L 0d  0 #0  - M  L0 0d00  -LM!0 0d  0 0  -0LLS s 00 S0 0S0 000P0S @0!0S(0  0@#!*6*6 p-LP@$0`T@ }$0T(0 R =?0@ 0xp@@t ]@Dtpp7 -L@'MpoQ(L'' PP0,Ÿ,( 0$"Q0 $0ڬ( 00S++++( 00S꘰+++++++++++++++++++++++++4K0(KPF`(0RP0S  !!CQ 0000P 00  PP<074=`a6<0 PUP#Py)p0`0$0t0 (PP0 L@0@0 `8`PP4#-003l3Ľ333Ƚ33+*6N(F$3 -pM0 0L Sc0S\0S L 0V , 0@( , 00S  F,@P;,````p0! P PP0 P 0P!,Pp0! 0 0`` 0 0 PP!L33ľ33P3l3*63 -L@0! 0 0   00 !P }e00(P 0(0 -L0Q@0! R0000 Q 1S000Q!%U -L`$0PU @p1S n@$0PU0S .lP@P2 -LP 0 R 1SB R@ȿ3 -L`pР M0 ,K4  0S -? P006ⓞ@FtP [@Dt0 PH"[2[ 0S44 00p73W`p}W -LP@p ` J 0@P &@X ժ Ӫ 3\3 0-LP@ 0P 03 -L 0M,0 0D Q`0S  4埪t,A!^ !AtrK    0 p4P 8` IWX@2 TP# PU 0S  PU1SbbPP cf <0]f@T0  S 3*63330 HP! 0 ,  0 00Sʠ `P ,0 8 4 `4PP  8  40 0RH ! !rW X  <3*6 -L M0!<"Q  0p 0A! 0S nP  $0,K4 XD0K@0 KlPPة4b[C[      0!R 4Ὡ    ᮩ |  $0X4P嗩B[  x0 }?R-? 300@CY@Dt Ik*633343\3p7! p-LP00M?@hl0##!000!ȡ#`8 4Pw\A0S 00p+6 53*6 -X@LmPD74,Yo P0  +63+3+6 -L|0 p Pd O0pS ]?P`@D`y0S @TT+6 +6+63 -L`MpW0PU 0SPU0!RXB!^ !ApK 0P ! ! Ѵp#@P᳨! ! џp1 R=?0  8pK P8pKYPEu! ! p 0PP@Pe apP- S@TTk f@[ @P Y1[0070010E@P@@&, : 3*6<3p7x333(3d3 0PU  00 @P p0PU p-`M0 00L0@000/3<0000 K P||||| 0000000 d fX000  000  0003<3H38<4p 0-LT@3\H0τ 8 τ,P,(/] O0H|7L3X35 -L ,S頭5 - 0L00 -p@LxPT dd0`` X`0d00X@0040 @WdP`~7 -L`0\ \*p0S8P0 b0 @0Px00 0S:XPD0 0c 0 00 f ~73~783~7~7 -L -0 Ll~78 -0 Ll8~7 -L`$ 0M1PSp+6 000A 0X$KP0 P 0 0 -0 L +6 -L -L -Lp 0`0CQPP@P \  0P S \ 0S \7 0+6~73 -L@ 41 S y00 R~7 -40 0LB\兦 0 1|3~7 -L@l M @ `p0  KPP(b  Y~73 ف  p-L`KH M0P0e0@P  ā cY~7 㸁p p-LP0@T `P :0@Tp p-@PL0 $`2U 00  S 0#? S i00p -L@0!! p-L@ M`PP 0SXޥ-0S* A70I O %Q0%4  03,3$3H H0Q  < 0 0,  (00  0  ᳥<3433p -Lp AP0`S h0ᝥ0S PPu@0 Ꮵ 0 `S PEu RD3\3 0-0PL R@ 0 M@ th \@T 333333333330 -L0 Q >3 -L`@pMPp -2SV P $H 08 `PV333D3 -L`@pMP V+   0p  d 0L 1<  `PV3p33333$3 -L@P P P P  ,343<3H3P3 -ML؁ pW ' ⠤́p!001 AQ` 1 0  @ @PxPx᥁pTT1T!TT0  ("(` ፁ ᇁ၁ @ z 9$s$(m(,g,0a0 t l 0(T33l333333333333 3(343@3T3d3x3333 -L,Mp@H5H`T@ 1 !,AP0   @ @ LL`1!(0ݣP P`1!0   P!Q  XY*TpP`0!A0          @@   $(傣 X3333 3333L333333|3333,33 333$343<3D3: p-LP@`0!DVT ,0 K9!pL3x33 0-,0L@PT D@T0+6 p-L@`KVpP0S *p0#?STT++0+0+P0! 0 0S 0,0r  :!;0SS 0SSS& P0! 0 0S ,r00< 1P080 \``2`< P ! PPp -LM, ` @R 0S0S70$$$2 R 0S k@ 0P[ $?00 S,L+++(+(00C. SC6B6<XVPU\`2< PU ( R  B>0RB&C&1!@0 QpP T VP㴀U7@P  V AT0A  TPU0 R  D00S S + 0 R1l 0 0(T  8 00S, ,0S o,p730, #?00@0!P,Ppr00 R ! p-@P0 L$`Q(  0~000#?SQ  r00p -LpP000 0!|3XZ0000 X0Z0X0S 00C,4 0::140  003 -@ M(pP0L , $ `4 W$0 0040#?S  0*, ,00 30S '  0202 0`0#?S+++D+lQ0h!P W V  @:`SzG` W Q@` 0P V@ 020RWRW @0`.E``, 0@%W ``pP@ 0\PP@` 08  00z <0`V@T08X`! 0 <0`V - @L !"F T40 X0“ˠ,ˠ,0 0,0\ ‚ 0 T0#00S01` 0#?S0S 0 0CR T \00c0,00 0c,0H+6 0-L@0 P 0 P g00R 0U00 #z0 -LpP`0! 0* z0#> 0 @ P 0 0S!0 0000 0a0C 0 00p0p! -L M< @ , 0!0 ,0QU} 72@ T4 % p`'08 S 0 0#> S00 0  8#Rf8@ T0@ 40  0@290  30CS3&3P" #ܐ00 P0Sx 90@4 0!30C30900S S 0<0  @ PU @PT%<0S 0$$@3y@ R 0,,@,y, R00 R0S 0000S 0 000  y, 0100! -L@QM, l `P%~W ᙛ 啛Q ,p@ 0 倛W  P010 0 W0#00Sp 8#Q 0 0S 0! # 3<3T3H+6@0!!@0!Q 0SQ, !@Y -LM4 @8 < H^xH0Y40" /$4@HOxHD40@PDxP 0000K \0[!P40U@001qE AT@( LB`R*x0 070U000!( BR \\0 0Z1P 330K<0U 1 #8S 1M -@0 $ 0LS00S2S $( PP0,S  -0 @0L$T @2@B@02@0S0$? N1c "gfff+7 -M L< 04$ $P 08pK@ #?S( Ȃ2@023  j 0`$RF ʂR* ʀR# R% =R/ ʠR" 7h3R2 3 R P3Rv w0@S.x+++0++++d+0 P0@ a@P@v0 0< P0@ a@P@v0 0P0 w  4S S xS uVZ*ZV1# 8phVZ* ZV1#H+6#+6 PqV`D!@0$PM ^ ࠡ@pJ@HvH 080K)   00  00  000040 !, @Lv0LS00!40 0 000S*ZZS1! 080K 8PP0v|+63@ Z @@R  BL,@@@40< !P0@S H+6 p-0 $`RLU@BٷB@d 0@ P g00R 00p -L`@ v02p (  002v0 0R=?0  3@GPC@G@IPEupT巘@u0  10 v 0 v 00uX0 I@u0p733 0-LP0 @ 0 @u0((@uP0  u0X!@@ u0H!44 u08!DD u 0 @ u0NA@u0 @u@Hu H0H<<2?,1(0p2<00 !K20 \0/0-00 q 1?2c0 "00 q0C0 K0 BP1?2c0 "K2?2c11!B! 12K00 +*0K0 ' 0V`0  0ώ$pK K0Pj40S0 0 0 3R AB\[0S` 0 0 3R  -BP Q  0  003S`Q  p-LL0`@mPUT |Ab0004 408000p7 -@3LS xQ 0D37 - @L| !d00bd0! !(00C(0( R  !R  - L|  !P00bP0! -LR@d 0RFP !(00(0! @00| 0!d00d0! /, -LR@P @0R P @00| 0!P00P0! (0, 0-LPt0@ Ux00 S !x00x0!P !x00ex0!0,6 0-L@PJ !x00ex0!0 -Lp`8K0 M]?P0 0@ 0!0^  0D02/0D0L00x2 |""1C22(,0, 2"$0$ 2 0#3,6,6:,:, ;,L:,;, -L@804M` \卉] ]P3p3x3 -L@804M` \un ]3p3x3 -L1p `R  t!00S0`VT ]`H1PP 0! R 0 0C0P 0000!@T0@P, 0pP 0|0 0`0i0j0 t  p0 Q *0!P0 00$@@!$0p7,63x377,6 -@j0LS  !00C0 R  !R \\0 Q *0!0 00 @@!0}7,67 0-P0LS 彈E ],P !00C0!0S 0 R 奈P  !00C0 R  !R ;@@k@@@@ @@l@G0,@0@<p@03x3p7 3 0-L0PS 0! R 0 0C0 0000!@@T0@P0 w; !000!j,P !0 00!00j000 0it0077 p-@`` ``P00p p 0L,cP !000! 0, 0 0(0$ 0(0 $ 00h0h0i`0t0k 0k  0W`Wp 0-P0L`z@P00 C0 00 ``0 R 0`04 0  a:d0d00D, p-L`PAG@Pp0 00 ``0 R 0`0( ` :hpD, 0-@PPkPPPP PPlPLW0,P0P;pP0 -LPp`P S@P'`Y @ ? 0 0 3R 8=\ @ 0 pT*0@J R: -LPp `R" R R@1@!-? 003Q  (<^ p0`d 0d0 PV -LPM0@S`0p`gP0S 0S* d 7" ?  P:5 d 0(0 7 0(K@p7=?0 0 0 3R   003S ;P V 00(0S 88"0#8 0f0   -LPp`R@T T@!p 90`d 0d0 PV -LpP `R" R V@1@!-? 003Q  ]<^ `d0p 00 d PV -LP`p0 V!:`cP0V* ?00f`W@1@! 0 0 3R  %<^pdPW  -LM0 , 4 40 S8 :4000b40 0  S*004 p0aZ @1@! Y4 < `iV=?0 03Q ;\f00Z000 Xi8  6V=?0 P03Q ;PUGi8 6p@f f8 Z @i P? 0 0 3R  ;PU%T -? 0,K03Q80 78  0,0 ,0S  0 c0  0 Z}80, 0,0  -L`<K0 M]?P@P  D0 9DK4@K!00D1~0 !dd2!paW%T T0R'0? jpRR 0S 0 S0S xD@@~ gE#0( sppD00 ~p -Lp0M !dd2!aQ:\`TP( V  !T0S@@T 0!t  t !!0! R 0 0C0P ```!@T (0 S  ( KcP  -t0LS  !t00Ct0t R  !R  -L@ ? 0 0 3R 9@T  -L  v 0-@DLRQ :d2PS 0R P'0T QPT0R AP/0SS 0 SPQ0 d0RC P3#P_ 90 -L@0 P 0C#aVVU  PP P00 10p R@TPP@0T00 p- PLU 0@SJ`F@TZ,p -Lp`0@ S`hP Qp0 0c0Sj^P0S S a PP\DQY= ?0l P 16 0<0Q+  1Q $1Q (1Q 10 0<0Q 01Q 41Q 81Q 1@0 0<0Q PPU0 000 B bR``V P PU PT 0S f -L` Mp @W  P0004P*0@00, ( ]0@ ?P 0  0 3R0K 8\ D 0  0 3R q8\ 00 @ 0  0d0  -LM< , 00 0C#1 p8 Q4 4 ?@ 0  003SQ 0 00 T@5 <  !000!S0!<0Ra ]l sW0a<p< < 40RSP<Q>1 @XP -? 003Q00X -? 003Q00X =?0 03Q@ X, ,0 @ 00 d < 80R,00003 0-L@P  4PP 0S J  !000!\Z+50 -Ld 00 00 SHH 000#3( <0 00C 0p7p/6h/67 -L 00 00 S 0|0C0#3l <00S H Q00 00C 00S 00C 0Sp7p/6h/673 -LP\ p`2 SS B6U: `pWWX7 -LP`lp2S S B: :P 0$0! 00  `VX7 0-@0L@PT W:P00@T0t$6 -LP !000! -LP -40 LR <0S0 Rt$6 -LP !000! p-L` X !^ !ASIK 0S ! !ќIX㡁P0@T 5Spw :Pp0@Tp4643t$6 -Lp@@PK` M }=oP9@cT p-LPK`@Ph00pK50S0Op - 5L .ll/6 -h0@L\Q=t0S  !t00Ct0t R  !R c3l3 p-L@5P p,0,`p0S PU 5055   kpl/6 0-@5L `P k8,30S 5 08#85k0l/6 -Lkl/6 -Lkl/6 -L`pԏ0P)0$ R(0:0R:P  ᱀ $ 0S 50$0$ 0k0  !000! PU 0S S 0R  @Ph/63 p-`@L! 00 0P\  `,0oP 00C 0Vp5> 0 S5 ,081 R P00 00C 0p00 00C 0)P ;t0S  !t00Ct0t R  !R acpP l! 00C 0t R  !t00Ct0t R  !R Dcpp7p/633 -L@à0  0 0^ 0P0 ^ 080 ^ 0 0 00A5/6/6|/6 -L@0`SQp0!!0\006\0 0S9P  !00C0 R  !R W  !000! 000@  @ 000!#00S`0S 0 0 0 000!t0S  !t00Ct0t R  !R A58t/6p7 p-LPR` PpT@ !000!  P !00C0!p87 -L p 0`S 00! @ p00!T Pt0@S $ZT 0S 00!P00  !U @8P,1,0 PUA5,3 -$@ 0L0 0 00C 0p7 -#3M L, d\  !000!d000 !00C0 R  !R s |2g$ @Hdr T  R 0R\ R I 0!t  t ! @T&3<0@T! 0S R 0R\ R " 0!t  t ! @T\ 0S   t0S  !t00Ct0t R  !R 0 S, 0, 0bS&00!P  Q 0P0C0 000000!UN  !0SP00!t/67A5h/6700!0 ,#00000!8p7 -L R0X7 p-L M]?P 0@ 0 3R8K 3\ ( P 8`K6 0 0 3R 2\ p -L M? 00K 0 3R4   3^ 5H0,P@p0T 0`1S U t$6X7 gPp`V0@T0p 4  0 0 3R 0K 2\  0-L@ 0@ Up 050% 0 0pP5 5 0% R t g%0&   <"5%0&   <"5[^,h_,l/6 p-L@`PP , <0 ,2'0# p  0  ' !00C0 R  !R hL66,,H#6-H7 !00C0 R  !R  -LPHMpᤠP Z !000!T \ ` L  @ ` 0 4@PU,-@P  0 "@PU@P@ 0 @P U @P  0 @PUh@X@h0 0T@, T04@808A6:644X 4@8 4Ж8$ 4,0` -L`Ppᄐ@  j0 d@P?UL@W@gT@T00`( 4084$ 4 - L 00 0x0@ S0  0S0 Q 0R 00 0 00C 0p7@8 0-L P 00 00P00 00C 00S @0S Q 0U0#00S 00 000 00C 00Q 0R PQ 00C 00p7@8 -L0P`p$0V $ @T 0S Q 0< Q$0  PPW P lp`VW l8? -LP@p` 0R 0W00S uP 0` 0"!A!@T -2@$ L0S @P$`P  !00C0 R  !R e000$ 0! 0p!0qPU  =kPH10\ U0S 0R 0 0"!A! 0U00U l !(00C(0( R  !R oS }t0S  !t00Ct0t R  !R ?8@8 -@Mk0L$PS  3  tQ t0`S  !t00Ct0t R  !R f`@V `\0 \:R0@S0 A0 0 0 0A088"0#88# "48<#\:Q:`$P0, p0R0 0P00S0  C0R :j0 S 0 RP 0  C0t0@S  !t00Ct0t R  !R pX 0$Pl0*PW50SL @T !000!= !0S 00S' 0S@0S ~P  0 U !00C0 R  !R! ~ !00C0 R  !R ~/P ,0X2@8A64X 000t0S  !t00Ct0t R  !R {@8X 000t0S  !t00Ct0t R  !R b@8 -`0LU$sP Up\ P@| !00a0!t0S  !t00Ct0t R  !R -T !0@0C0!x44:6 -L$!$0PC qP8 @0`PS @0S R80808 00C0$sP 0!  B !000 ! 00C 0 R  !R ~ 40?R040 ?RQ:6x:6\7:6@8 -@0L3$jsP ! 00C 0!0 R80808 0000C0 ! 00C 0!000(04 0(0 4  P  0{ ! 00C 0 R  !R ":6@8 -L ! 00 0!40 R 8080 000 \7:6 p-L`@P㞢@P !0@00!tTp 0  000 00   $0 $ 0@$0 400 0p:6,4- -L`0P$@|3|#$rP ! 00 0! "48<# ∉ᨉሁ!48<   !#8bp W0 W00  l0pSl0W0pW $0`0 `R0b`0 `0 hS0` 00@ T@T @0SZ @0` 0hQWf` Q0 a` 00l0S0l0T> @0S;`cQ*0@0 0a`0 00a0l R0l0'Z@@@0` 0b0| !00a0!t0S  !t00Ct0t R  !R vT @0S@Z@PP0` <00| !x000!X000t0S  !t00Ct0t R  !R E7|:6:6 -Lp$MqP ! 00C 0!0 R80808 0P000C0 ! 00C 0!000XR@0S R$0 0 QZ|]@Pj 0 00 c (0$000l 0d0``0l  R 0`0\!  $PX 8" ```0 R 0`0! ` l l0R 0l0Rd d0  "d PU,P !000!,$k0k077<0*(0"48ẇ<ẇ#800000000(ZR:6T44-@8-48P , 0FR 4004004@8 -L1!P,0 0,0^$@E p` 0'#.0##$,0#d? P 0S0S 0S 0 S0!  !P@T 0PS 0RP ! 00C 0 R  !R t 40R040  !t00Ct0t R  !R @8:6t:6\7 -LP900@S ~P k^$0,S0 l x0Ry0X0 p d0 `r 0S0 BR :j0 S 0  R R 0  C0t0@S  !t00Ct0t R  !R PP$\0 0S00 B `00@S0@ 1  Q ,0`$ Q V ,0`$ QL  <@4<<-p78D0DL P`0^00@ 000,p7@8 -pML0 ` P$0`V0S 0 0 0X0V00l ZDY040 24 S S 0 R@ 4  @0 ,K@2PP 0 00 p2Zp0 !000!,@`0 R 0`0!$@P=E0("(0"48<#8040042@0 9h0S20w2 00p 0l @@ ȜȌ" ,Ƞ 100c  00 , ,0S,0\P, ڣ20 P0h0,0 ,0SB- 0,0 t R  !t00Ct0t R  !R ޾$0 R`  0,00p7`8 -pxM$@L0@ 0 00 040 ,48 <6 ,0 $(,$, @ 0j< @ "z80 <`8 X`10V`1 @PPcG @k0k0`0p p 8 0`00 00 0 RX"᫽0$0 0 0 \  !(00(0! 2|0 !d00d0!,P 0!   !,0$0 0F4f  AY&"("48<$@#80Z@0XS 0 00L1L!@  (Q`0"(00"48<#804  4 0 00 A0 0 0 0A088"0#80,0@P!XZt0S  !t00Ct0t R  !R , 0 S`0084,F-/,@8p7t0S  !t00Ct0t R  !R ս( 0$ S`00<   p7@8 -Lp@`0\: c`J0PlW  pe0 Z 0 RZ  R 88"0#8 0 -LpM,\@K 0 P?0X [pR` ph  `@  \0Rp|K $0 Ph0K0 `K0P@v|p 0x@ |KlPKPh$p0 p2"0 0 @0 w0 P !00C0!$I- -L 0 00 A0 0 0 0A088"0#80 p-P, 0007T`LV @ 00 0 @ 00C 0 0` 0lS0 ` * FpP0S 8pXEt0S  !t00Ct0t R  !R pp7 L-p4 -M$0 L , R t00   0K 0 0 -M$0L K  0  -L M$0000 - M40LS $00040  p-L@8M40LPKS `P 0009@0K00 p p-P 0LB` @  @  @  @  p p-LP@0` S@. P0 0c0Sp0S R R @ (R( ) P pP 00 0 000 B bR@@Tp -LP?p`P0SV O,! 00 0 @T. 0S'V 00C 0P a00 00C 00S  !(00C(0( R  !R ៷ᙓ@TP !(00(0! 00C 0 0h0C 0p78 -LP@`8#x] @PX 0`00 00 ``0`02"r0C c" `0 aR0b`0 P0|@ 0S 0*0 P0 !P00P0! 0! 00 @@!0S`0S t0S  !t00Ct0t R  !R P(0, -LPp8#h 㛺@Pc ``0 R 0`0d!\$`p0 00pppp0p02Ტ0C0c2`0 `R 0b`0 P0|@ 0S 0*0 P0 !P00P0! 0! 00 @@!0S`0S t0S  !t00Ct0t R  !R ںhS-(0, -L @`p$M0!PQ 0P0C00000 !Ue `X0 00 2@PF0S  00/0@P 2$ 20@@KK0K0@S 3K$0  2S  0@啿0@ d2Q0Q:0 @0d2t0S  !t00Ct0t R  !R T -LQP` M@[LT3!YS900S"Y&T =?0 03Q ^ /T =?0 03Q\ H 2  0 R $000 00C 0 I#RZ-@[-p[-X-T_-Z-HZ-hY-_-[-[-Y-Y-_-x_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-_-\-l\-\-\^-\^-(T0D0 DK 0P4p8`H ? RD0 S06`1D0 !2!P4p8`D  xX 4p28`024p28`02X 4p28`02{4p28`02uX 4p28`02m4p28`02gX 4p28`02_4p28`02YX 4p28`02Q4p28`02Kp70\0S-? 1: 0<0Q 4p8`H 24p28`S- H0H0#0Pp# !00C0!T.xx30HS(4p8`␂? R4p8`0X02X4p8`⤂X4p28`002@0! R 0 0C0@ !P t0S  !t00Ct0t R  !R ? R TxX4p8`⡂T4p8`0X02? R TH =?0  03Q4K4K T=?0  03Q0K _\4p8`,P00SH 4p8`y@P <0,0  !00C0 R  !R u@b0T4p8`H0 d 0 H , S R\0H0 "4p008`2TTg TH =?0  03Q@K \4p8`;@@Kx66:6@@K =?0  03Q \4p8` #YwixX 4p8`H T 4p8`2X002[04p8`H0 00 00S b8 000R #5 00C 0H 00 00S M000808 4R #5 00C 0 -L@`QtMp^ -? 003Q  \3  0 RP 000 00C 0 F!R2b-b-b-a-e-b-b-b-d-b-c-b-b-c-e-e-e-e-e-e-e-e-e-e-e-e-e-e-e-e-e-c-c-c-\`KQ   00 00S ݴ808 40R #%5 00C 0 R  0  003S[0X)0Y `1`!0 0003Q`P DPKx222#1212#220 20 20 20 H00 P !000! $00 !00C0!`V 00 00S s808 40`R #4 00C 0j220 20 p720 Y `1`# 00 00S P000808 4R #4 00C 0  0003Q`P K0003S  P  00 00S `808 40`R #f4 00C 0/0S[h d 2``  0K0 xK|  0” ӻ2 xK0K0 0 ǻd0  `c 000 3Rz`w2000  00 00S ֳ000808 4R #4 00C 0[\ 00 00S 000808 4R #4 00C 0 I0?R0S QʅK0` 0003Q`P .0003S K P Y `1`# 0003Q`PK0 003S \  -Lp΁QAFLF0`!60!000!0PP!0S00+0Pڌ0S?1 |Q0 0030P@0S 41 0Q0 00V 1P Q0|0 R |0P 00>0. SC6B6QV0| 0/ S0! S;30|0 0S06C0 !00d0!8808p7,8:6:6$8 -L0 S. SC&B&T!00b0!04: #:0R 0 Q008088 - L| !P00bP0 !0| 00 p-PLD`RQ 0 SLPApd"'0R@@S 0S@A0@ 0S2-  Q l1S 0Q0S> RA@ |0 c?RAO lh |0A c?R@> 0 @p -L -L@1`Q  0CQ\ h1QM d 0 S1  0 RP 000 00C 0 0S2p0S > R l!0aS0lS p\ T T0R X0   pbpa 00 00S 000808 4R #;2 00C 0> pR l!0Rpp 0 S 0S2p 0pc@=?0 0003SpTp7 -P0/0PL0p1|1t1婋`P G  0AS000 0S 00 0xa 00C 0 0 @PHH P"48<#82 !00C0!08 00 00x1 00C 0݋an<;6p7 -L@M|xqU9" 00 0x 00C 0|0S 0 , ,PA`V  00C0$  1c 0`V0?S0S \\<ᛋ`ZG 8QDq(@ 00 000S $$< !(00(0! 00 000 "D 00C 0 !000!s 00C 0 !(00C(0( R  !R `? < ` B Z? R $P<p708 4:6X4 4 -L@0K 0Mm< ?`4` 80 v 0S2b Pd2S 0!dd!`V 0S2 0S <0) "F R B 0S r;gE#p7ppD8K4T20T2  0S8K s808 40R #0 00C 0V/ 00 000S 00p 00C 0D 4 0T"S1 BT" -LP@K 1 MM?@D@  H0 p| HK08KR|H!#21@ p(AD8KG4+00-? 0S@| 0RZ: '07dbV4 00 00S 808 40`R #H0 00C 0| 0RZ .p 00 000S ᷯ000 00C 0ZgE#p7x 0gXC8KD004 -L@P0M0@ p\3  0 R ፯0000 00C 0 @<  3, S2 <, K40L0 8P P0 H@Tp Q $`0Q /*1S  0@C@ D 4 L 08P 80 P0S80 4P J44 Y00Sd2S}'00S < ~lP``@fQw@0 dRsT0000cR@@ T @S! 0` S0 ` p!'-? 003Q  \ 000 ` f 0` S0 `  ? 00Kd 0 3R  0mT 000  dDD 000Y80S  D00D0\0   aRyL00L0 sp70S  S, 0S0Sj% N0 p10K;0^00\K ΰ!00P  0S '0 0 -L`T T0PSP h0S @p00C0p p0p0 T0SP h0S 0 #0S0 0bS Zژ0 0SP0SX00Z0S '0 0 0S0C8!@T'P P#X +/ -L@@K1 Mm?`D`  H0 HK8pKD40 00 00SP 808 40R #C, 00C 0T T0S * 00 000S ᴫ0 00C 08D0 gE#p7 p-P !P1L0P1@| 00 0`44 P 00C0 40000Q 00C 0Dp08p7 -L`0M@ @0 Ѐ3  0 R c000` 00C 0jP 0 S T  < =40 0D0  0,K4 ,0  2 S 0!< 2rF 0!dd!a>0Sj:Y 7 0S080 40H0 8L Y > R 4l!0R$ -? 0PS Y< R 6T T0S@@T 40@ 0bS 0 0pb` pGW:D^0h0@ T8Y0S Y d2S 0S '0< R0Sd2S'0 0S <0S  pH0@S^"@P HP0 0L0 0PR 0"Y6<0S<8Y"p 00 00S ɪ8 000L0R H#+00S Ꭺ000  00C 0p744<< @ R P0Z \# aT10T1 0Rv<0Ss P0Zn # aX10X1gPg> Z P1R l10aS *S0SpPE400P   0 0 P #2मPP4000 l1 e0bS> R  X-&1 <4<!4"<0` 0S: 0 DQ h 00C0 00 4 D0^000h0Z@Q <0S Y 00P0EYP0Z !X10X10H0P0  00 00S 8 000L0R H#D* 00C 0 # 00 00S 000808 4R #,*< 00C 0 000 00 0 P08p7 -@ 0 0pL 0PU` U V 0 R@  00 <0S 0k3V,0 (R@  00C0 P:6p7`8 -L@ 0S2 P  ( -P 0LS 40Stt40S dd40S 0SHH4!0S 84 !(00(0! 0!0T@`hpt0S  !t00Ct0t R  !R R 0 0C0@ 0000P@t0S  !t00Ct0t R  !R ̫ R 0 0C0` @@@Ph0S j~40 S |0S s40S m4 !00C0!!(00C(0( R  !R U44, 4x 4 4:644D4 -LP,ML `02  0 R ረ000 00C 0 0' S  0 @<0S 0f2T 0S@00  B 0 014P 8 T 408P0 T@T 0 D0L 0bP3T R 0 0C0@T 0000Q0 SU! 101  @<0S 02T 0lS@00  B 0 0'0S Q 0 101p7`808bP &LQE }?p@KDp 2 H0 HK8@KRD:, 03( 00 00S 8 000T0R P#L( 00C 0L&L 00 000S 0 00C 0 RL\8KD00%, 00 00S ק80@0@TS P#(00S xxI3 !(00(0! 00 000BD@ 00C 0 ^N P! 0 @<0S 0j1T 0S@00  B 0 0C' 000(0x0 !b\1\P`0Q1/ !@000! CRgE#p7 4>`808:6p:6 0S9 0 SL!L1 Q|0 S+0!00P%ڶP 2 0 @<0S 01T 0S@00  B 0 0& 000 !l000! 0S 00C 0 !(00C(0( R  !R ᇥ:6;6884!4`808 -LP 0`@T 0 p<0S 00WX3 TR@  00C00 0 Tz0#4 R 0R L?@\0lPP @?<\ 0` ^S:6 -l 0LQ\@0S0cQàQA00 \@0S0 Q@@ B:6:6 0-L@0P000@S0cPP@81S :8P 0 !QQ0AS81%8!50S X081 S0S0`R8!%815<8! 0Q<NF -0 1LpRB\ A t0Qap #A0t01p0!t pt 0!0C23"1o !Rx 0x0 0Rx07. -k0LS&0$Qp o0R A t0Qap #A0t01p0!t pt 0!0C23"1 Rx 0x00Rx0. -Lp`P1M@80ppR   00C0p L10CL1 H10CH1P1S0CP1|00C|000C0   0=1| |0 c| 0 `l| 00Hh h0S^ 0^ 0 00bS 7 0S B m|0SB2(7h0 xS0H`81 ab\ Q1 0 0# 0r1  lBP !(00(0!L1S#H1S#0S#|PU0S HQ lj #HQLQ Tj #LQQ <j #P .$4-'4'4H(4(4(4(4 0-P@M0X LD00a??1r1'?x 0\! Qhd0 0 0g#HP0 0r1  AP  !(00(0!.$4-70 -Lp@M` 0P fQ,48 <#8 T 0aSQX0\^ X0pT S 0XS> R  -& R$`0Sp1p!S 00C 0L ?P 0d2 00 0P00gP00` 00W 0 Z 03| 0!P00P0!T| 00b0 0`  0``0D S   0 @0 pR 0S"0A1S 0S> R  X-&1 <4<!4"<0Z R0Q}D00cS   00 0<@ a( X 0S pD00@S T1 R 0aS R l10eSP  2` P 0S 8 㕆l!0R00>, lQ>C0p;6 -L``0Ppl 00C 0lQ@  L ʒL P P0 0gP0 00 0p0d2 00 0p7 -L00 S \@ 00C 0 `d "  00 0 `d " p7 -LPp@` 2+ R@ 0RЀ X! 3R !<4<("4!̃<4<("4 < aQ1 0R83 !Z ŐQ =1S "0=1R 0 u=H?0P  0RP 0hS00 S xd  d 00 7P`0 0h`0D0 02l0S ZPP| 0R%T`0` 00 ` `0 0h`0 `1 P0| !P00P0!0| 0b0D   P 0R  (Q ]=1S "0=1R 0  0) Y !0S "0SP8@0 0bS0P *!0 S "0S  R ]Y S N 708j- 0#2Z :l0S PP 00PSS 3R00,$,8#$ , <4<("4!<1k\" 0S 1 0bS 10#~9 ;QPP 0"80080 @ 0Q#1D R00\0S^ P 0 0 0@ S 00bS1 0cS1 ~9 ;R01 0 @ d1R 0 0 0 00 0 ,+ 0@  0 S l!, <4<!4 < c  Q *0<0 Q hQ 9=1S "0=1R 0  0^ 0 0bS0P*!0 S "0S  R1f/S0S C@= 708@8 00000@8 -L`P@My  P 0R!1S P `X!00b bS *H#40040 0$#101 0 2 @0,T0@   Td!48<#8X00hS008!2R8!810S |2  B 000S 0@"101Q 02 R00`Z "@0S?#WSX03 H0pS Q10S  X-& <4<!4"<0000 0S h1 dR@  0000 0 @T P 0S !U1Sn0S 0@0 00,0 0 0 0( {5P_ !(00(0!WVVQQ 1S 0!0bS 0~) +Q 0 7087B:6;6p7`80S1 0. 0S0 R@  00C00 0 R 0 101@`  T 48<#8X0\0< 0S?#WSX03 ᰍp7`87B -L@pP `ǡPn P  P c 0 P\ 0P  00PS00S 3R00,$,8#$ , <4<("4!<1\" 0S 1 0bS 1<#~9 ;QuPP 0"80080@ 0Q#1D R00\0S^ P 0x 0 0@ S 00bS10cS1 ~9 ;R01 0 @ d1R !000g , 00CS .p.P.P.P.P..P.p.P 00 0S @1 <R@  000"0 0R P 0S فP !48 < #82X0 @0RT0 p0S0S 0 0C04p 0S?#WSX03j X-&1 <4<!4"<0 708p7`8B 0R 0S3 R@  00C00 0H '0R0'0 PQ @3  0S1S D@0Q3  0 a0r-Z 0 P<0S 0BU2 R@  00C00 0 0'0RD"000P,2x0$ !b\1\]L0A^F 000S  T< $ 0R3 $ 0R* 0 P<0S 0U(1 $R@  00C00 0r 0'0R 0`  0 S l!, <4<!4 < c 1 S *0<0 Q 00C S-...H.H...4...4.p7`8708:6p@0h!0bS'0 D@0P  0 `0rZ!000  0S4 Q t=1S "0=1R 0  0 0 0bS0P*!0 S "0S  R1f/S0S ~ = Z)08 -0LH0 S <0S11 B p-@L `0Pcj 0S2 !1 0R 1x0P! PcUQQ%500 p7 -LQ M,  00 ,0pАP4P  3 R p3 Rp2 R p01S  0ₑ0` 0iS0 ` * " ` ` !,(00(0! d2| 0!,d00d0! 00<4<("4!<0<4<("4!<00 I1& 48<#80  ."48<4 4 @0,@T@C?40P10,0!0  48<#8001#$(,"(!0G ,'<4<(0"$A0 <00p S000  <4<("4.<,$,08#$$, S P00Wb @0(0,!$#, Y:6:6:6\./,  00 S <4<("4"!<0  <4<("4!<01S4 pL1,$,8#4 !, P1FW@<4<("4!<0<4<("4!<0p1@W1S 1 !0C1,`  000 4!0S 0C!00$04 0#0 0`0 S |0!S@0x 0cS{@,0$ 0cS03"050 (R@  0 00P 'j0 S00\19| A0S0 0 P 0( T100 j \  7p7@8Fh -p`hMLDP``|R| | ` vPs`0 S*L0!0S1S S|0S  0B  S 00bQ ^ 0CS| 0B 0S:L0 0XD 00bS\8 @0H0<P,`0DS 5|0`V|`%x@t0PTd`0 0 0D@0ra0010P !(00(0!7.,4.0S` -LP``0pgЀ@P 0|S# PៈŸ0S 1 Q0 000| 0/ S0! S;30@T |0| 0|0 |0 c 0 00 @00@0D D L 0L0 $R040L0 g$ ! 04LM00M0 H1 0H1 刀`0 R 0 ``0 g 0d@0` D0R0`p00` H0dH0 "@@ 00008p7,8<. -L0!6 b BR c c/R0D0\ `Q RD0`Q ! 1`& -LM 0PS H㴖Q $`0Q 1S  0IₑCpW h0 `R%`0 S*L0!0S0S S|0S  0B S 00bSQ \ 0CS| 0B 0S:L0 0XD 00bPE `0 S  P<pA0H0ׇ P10S0| D0 0X|x@1`T 1 0 05@ 0r00.P0!(  ( !`0 SD0505pWyX | 0R:d 00000R @0 x0 aR: |0S0S7.,4p". 0-C0L@PP \b0lQQA8!0@R@1S0cPP@R010!?Q0 !R l0 <1!S<102R.(L.\V. 0-@P0r1Lp!R %P !(00C(0!0 0 #0R %P !(00C(0!2-S %P !(00C(0!0 0-L@h2Sn0d2 0 P<0S 0Ul0 hR@  00C00 0 0'0R 0000p7`808 -1L!@P0` p0`SVh \1P^|0 SJ* 0 0bS9H!00W000*41 R/H$0 0cBS(T $0S#W ,0S$P 0[![[@1[$Ġ Ƞ̌,Ƞ+ 0W00& !00C0!$0   0 @PKn08@;6<6708<6<;624@8$0 0H 00008@8 -L0`@pP TXoV V`Pl  @Pf H`000, ,004 "4,0t "$0 "P⸆2S06$p1c` R/#WRX #0S DD 0 S00!0Q 0 "0# "B(" 0B$"0C  01P0S0 00@P0d  d  Q#J0S0  00@00` H00H0P L0V0L0 !00C0!nBp14RB5B5B508 -L`PM @$0K$ Y P $0S d0$ t#p @!0' $0#C8# C4# B0(,0Pt 0S 0S0S 0S S P 01P 0S 0S0S 0S S P !(00(0!P 0S !(00C(0( R  !R 0GB588 0-Pl0LS$ !48 <#8d  "! 0` LR $@k& "48<#8  "! 00l0("("48$< #8   "!d034 0-LLP @0R00 `0P*0 0`#2Q9:l0 S d "   R+ 0 S P Q  I `0P t0S  !t00Ct0t R  !R mo0 000000@8@8 -L`Mk@!T- p`0a0l`0$  $ 0#2Sl0S 2Pl<4<("4!<@0   00 0""1CD0H@<4<("4!0[S8 0 D00H020S0&0S @ 400bS0[S D0 0bS8008S0H0)V L 80080 V k788<6;6p08 !(00C(0( R  !R 0>88 0-L @0^Q 0S00  d00Cd0 0  R   00@ !(00(0!0SP0@P 0S0  00P @P0000B564 -L`P2 pR 1S 0!0P1 >`V= x@ 00 !0 022 22&0&0 (' 0,0 4 8 0 0S 0A<0d!@ 1D0!0XAcH lXY0@0Z00YP l 0 @<0S 0Tt0 pR@  00C00 00 0'0RA<6<6 <688pT74p7`8 -L `0S9  蠟0pAPT T01 X  !(00C(0( R  !R 0=`0 AT0 00 f0R  400 $00$0<6<6Є708887$<6 -LX R T0SX XT00 X !(00C(0( R  !R ,0 = 00CS0 88<6$<6 -LP0X CBR T0SX X T000 X 0C0 !(00(0!@T81\@ʻ?(!0?ABcT@1 p0 @ 0L0"`  p0R 0L0 00 00 00 00b S  00@t00ST0 T0X0PX00S04 <6ov<67Є78<67<<67$<6 -!L1M0 0 Q,0 Jp0 `, 0bS" 1@T4 PT  0X0 !(00C(0( R  !R p0<@T00S8 `( 000 p$ 1S  8<677788<<6`0pY8 000 00jS0  ,0 0,08<6<6$<608 -LP `P /@@@0 0000@4 4@8000L@P@T00T0@d@h00h0@x@|@@@ @@@@  00"0@"p@000  000000H@P@D@A?01@ T ;A?Ap@K?t0x0|@@@LAPA10``IP:Q@xAA|Ah!šdBpB(`|!!000!0S QL102D0   00Q 1 R0080<1 0#10S0 000 "" 000Q881  !48<#82X0\0Q 0h 1 00000` ?R:6 0b3ᾠᶦ0l-$8;6:67 -L@fM ` PŠKА | 1 !QoK0[ S x2  N  l 0 R#1  ~9 ;^ R <0^@0 S WZ$0 Z0PD   0lS0bS  R00P  R  $0Z{ T!80080v0[S 0@ 00bS00@ <Rp B d 0P 0R^n0S D 0R,  0`P 0!0HB00CS00S00C0/0000!(`R|QPQ00. 0P000&708<6 0 0 0$00!0HB00CS00S00C0$  0:0808 -L@`0p 0WP `0U 0S  0S00 !(00C(0( R  !R ^ -L0p0@d 00 0 R 00@ d00d0!(00(0! 00C 0頓8p7 -Lt 00 0Q 0S00  d00Cd0 !(00C(0! 00C 0p7 -L!P 0S0S S0S S 0S S -Lp0MQ`U-  0<@@PP#   0<@@ @\  0 R0 "ꠓ8 RT bP PTU !(00(0! -LP`M @2p 0SA0A S X. .<.<.<.<.<.<.<.D.qPGP 0p`qP\ʜ!0\Pp  0ZP pQp"48<#h2  0 `000]2W00S dR?6 -LP0@|@ 0S 0*1 0 !P00P0!T 0! @00@!0S` 0S0 Q`000t R  !t00Ct0t R  !R a(0 (R`  000(0,p7T8X8 -L$ ` !48<#R0`00$0  0 -L c -Lp@PcP U, 0`S0 0("("48P< #80R0@ l000 A0 0 0 0A088"0#80 -L0DM`0 \ X0 RY#*0^0S S@0S "00S0?#|0S 0S 0,0 4 00 S 4K⺤P,00S0`0 4 ,04 S< 2,0 , R 2@SL0S YG 2v 0pp0 S00S200 <0S2<0 TK <@XPK0`T DpKP@ TKH` M@P$X d0 @ 0S 0 ,0X@0 40p 8 S< l040 40K0X  0@ K0\\0@` R ,s8XP !00C0!\TR PQ <0  0\ #20#RPt784й..7 -L@ d= 0-LP 0@SR0!0SP PP b000PP000HH\ !00C0!0 -LpPM` ^AQ00  g7 ,0Kc@P,0 `V0 00  0/dP, 0S  04 -L@M,0p`SdS[x0 0  0P b PK$ jPP kpPPU> 00 0 S mP@ 00 0w (E 00C 0 !400C404 R  !R l !400C404 R  !R k<>4=67p7t0S  !t00Ct0t R  !R V p-`M @LPT P5x 0S  PK0 njP jpP=6p -L M, p@5P w00 4x>4p7=6>4>4@T( 00C 0Q ^?AT' |`KPUἅ 0 k 00 0U  ]0pW0W@TQ ڀ  0 n0b0 RZ p7=6>4>4>4?4 -Ld=6 -L0<@6 -L 00<@6 -T0LD0H D 0c 00RH H0H0S*0aH07 -L0SHH 1R  300 R  000p7P@6d8 -L@P`pR0 Š0 F⽊88"0#80 0@⯊ -L<14M ` P P,0L0 'Pd@Pa@@$0 P0"L0p ,@ 04 S 0,` SHK $04pKPL`KL0P@ҍH D@ HK8PK3~P5 L@\ D 0!R \^ \ 0S 5 8@6`@6 0!JP p@00HPL0 0ِLP !00C0!*. -LM , 0 P k0$pSd0\2 0S H 01 P R 0S 001 R011 RA 00 0P  00C 0  0d1 QR 00K@ 0K0 |`K P9댐 P @ KK}P{\@KZPPkhK VK`P pp gKh[d 0 唂 W0[t@ S|  P !00C0!K \@댐 P00KK@ d}PGZʬX0 Q ZR Z 0S 5  P@6p78@6`@6 0!xP 0 $0X[ g S =0C0a0CRl l0 0d`0@  0l0p K0P !00C0!I 00C 0.p7 -LZ@`Mh!000~0PS600S.////,//1 R 0lP!  0>0#!v V 48<#80 lP  0#0SCx0 RP lP8 $L  @0@ / 0, A$pT 08Џ8@4@44@6(A48@8@  0<@@f@PQ 0@R0S  T -LRM 000080@0S S $0 00 0 Es 0-L00HM\ 0T0K0TKX \ \K,@60 0-L@P R\M 000/08pK⮔p0 ?B8c02c2cAl 2ax2/L#b!<4<!4"<0 0  hK`0K 0` K K_0K 0h d0 E.Mb0 -L p-LM,PR`Rd0O @T !000!D Q0 80 R@0S) D0S&  0R A6Q 0Pp0 0#QkP `t0[0p  q0 0r  s000[[ [ !00C0 R  !R rdA4p -L -LD!!h0V00@ P,pC 㫇" : R7d0 R0 R.0S S 0S S%01  F0(00"(01t0S  !t00Ct0t R  !R M000080@6P@6 -L0"%@P 0 0008 0-P0L@S n0S |o !00C0 R  !R $] 0S,t0 00C0g%0C4pC4C4,8 -L`M !^ !ASHK 0S ! !D۔IT$PPJ T㰊@@` D00`P@sh@T p@"%-46C4B6=6 000!000! p04id 00 0P!000! 00C 05 M ,8D4p7 -LPX!!^ !ASԝK 0S ! !Н0 0R @ `T p MP 0!  B !$@0T0C0  00 0 00 00C 0Th !00C0 R  !R 46$D4p78=6 -L 0! R 0" P 0  -LM, `0 !^ !ASVK 0S ! !RhW`0\5@pT1 P0 0Q 0 0# p46`D4p7|7 00 000 00C 0  P 0!  B !$ 00C0@T 00 000 00C 0  00S P !00C0!#,0  0R0C0,8 p-@`L,"!^ !ASԜK 0S ! !МPUP !00C0!#!00C0p000PQ? \a0 0RP0P/ 0 0#* 0RP 0!  B !#00C0p 0R P 0!  B !|#0000Q0Rh00@ 00 0@ 00C 0$ Ip46D4 8p7|7 p-L`P@!!^ !AS;K 0S ! !7O<UPPP !00C0!$#t 0h0C0p0S S LL !000!P0S00p46D48 E4F -L@!RP P !000!@ p-L@`P !^ !ASӛK 0S ! !ϛLL R 00& P 0 p46\E4_ -L@ HK0MP@ L ? 08PK 0 3R `  ᆉ^ wHK:9K^PLfHKYQPT " Y:00T0pW P P@ P @T HK⦋P3L0Q0T0S |3QX 0BS/////////0000 0000Y Tb3[P [TV0 0 <4<("4 ,0Z1S0 2S00ST N@Ph Y HKT  0S P l T5-0 0 <4<("4 ,0Z1S0 2S000 R b !<4<!4", T5 0S 0 00 00  TKg 0Rc P $00Z 0SV 0 0 <4<("4!,0Z1S0 2S00SP 0 07<4<("4!<   R &0S! P0,$,!$0#<  8#8SA(A$A"A!A 0a0Iee 0  0 3R HK /\  -L` M0pS/ PU+ +V$ X&D@K う ( $03K0-00 ? 0  03QDK \ ` H pPU -L P2 \P 0 0SQ 0 0!\ d0 R P 0S SP 0 0 Rt$6 -Ld|7 -Ls|7 p-L`P@!!^ !AS~K 0S ! !zHHUp0D SE/H////`/T///l/k006X0CS30V@P 000  00 !000! P00rSiX0CS I P @ \@Tp46E4E4H#6 -PP L$\0004 P$ 0SD0P jA6t$6B6 p-MPL@`T@ 0S 0UA60U i$B6p -L`PPM`:`@P; :. //>ҟ $, p00 00`00 \p, V Db<0@2` 0@2D"T0`2嬢2, 3#0  h3\#PDB6A6F40@ -0@LT 000 p-LPT@`t0S  !t00Ct0t R  !R G R 0 0C0@ ```P@`t0S  !t00Ct0t R  !R G R 0 0C0@ ```P? R 0S  Ap0S:pP0S 3d0S |-|0S h'0S T!P HP !00C0!pTH4H4H4I4xI4I4 -@00LS 0qP 0iPS8_PQ 0@P. "48<#820 PP rP00 pr 0S2 W HP w=?0 PPR 0S P00 00 00S A000808 4R # 00C 00 !d”d2!0 0\0fPPlP 0p7 p-L`M0   K PP; 0  0 R@ A000 00C 0 0S2 00 00D0Pb 00C 0 00 00S $A`808 40`R #k 00C 0p7(J4p -L@S 0Sj 0S2 ^ 00S0000 -L`p M@P \P @0 K  0@0,P 00 p-L@P0`SvP p0 (p -Lp0  W00 `@ P1  0 RP n@000 00C 0 R 0S2000 00S S  S j'0 0'00S   0X000 00 00S ]@000808 4R # 00C 0p7 p-LP `F@P8 n000 p  Yv0 0 k 8 #4#00"`P 0S-? (00(0/00#08BD0P?! !DP6|a408 -L`MP5 P <@K ]Pp Z`V9<0,Y`P1< 2n`: S*R@P' Y? `R  !(00C(0( R  !R ,n`  P !(00(0!@ sY0` -Lp(M@`L TY7` H K`P/!^ !AK2`P S~ ` PPx  lH0/@0#0 RK `pD@K R]P 9Z`Vw,0`SqD0T0!^ !ALK<K]`pvPP<08 `Q 0SE L D 0"0)``P:D0T0! !;IDp <00S a`? H0 tP0 0A0D "0@ A"`)RCP0! !"D 0T0! !Xva` !00C0 R  !R 08 -LP@ M0`S%  KpP$ J*0S 2SWP$ ?$0K0 0"P6 0$0 0 S S R @T P F !(00C(0( R  !R + !(00C(0( R  !R +$ -Lp`4K0 M]?P8P  <0 l0TS 0 QW 000 0pw= ?0 Q0 # 0! 00PP!  !(00C(0( R  !R p( &(/nt0S  !t00Ct0t R  !R ,V  !(00C(0( R  !R H(0 -LM4 8 ^, 0 0 S 0Si0 , pj0,0 W !(00(0!4p '08 00Rf08  0 Pb, K?00CUP U0. @0(@P 0L0 UPR w``0 R 0`0$!M+ K.P,  t0S  !t00Ct0t R  !RP  ,M0S+'0(T 0! 00 @@!8 00 R8  !(00C(0( R  !R '86ꤏ/t0S  !t00Ct0t R  !R +8\0  ? Q0,0 4 R  !4(00C(0( R  !R 4m'8 ,R - 00LQ 00 g -Lp^ P`M( @ 4(0K/@P- !0S `0Wp*0 00 0k/P( 00<0S x<P Z1 (p %/( -Lp`<K0 M]?P@P  D0 FhDK4@KD᤬@@\0Sd2S'00SW xhVpfgE#00D ᠬ -L M8 < p BD , 00 R4 ^ D  2 S 0!h3y0D0 0S0@0 00@0,/0!^ !A{KT`H 0! PR 0P 0C0 0000!U28 @0R 0!ddR!aQD '0 YD H ! !c{ R=?0 RH0!^ !A8{Kv<Q 0 llP ^000<0 04Q ,  4 ,0`0Z @1@! +P 0!`0 00DPP!8Q 8 D8  d00 8 '`0T 0d`0 <0S e`0St0S  !t00Ct0t R  !R 1* 0S<P .0 0!`0 00DPP!Z>H0! !z8D R -L` @I P'0U0'0 !(00(0!U& ?pW"@@ '0@0'0T P 0S   P 0S T U  !(00C(0( R  !R {% -L@0Q 0Q %=?0 d@0003S@ 0 ST T0R R`@=?0 0003S@ m7T -@DLRQ gd2'T S0PT0R A? R 0Rd 0S -L` M, pn@ QUM 2S 0( 0 S800/00"R 0S00 0S00 00m2@S 00@  Be2  R@Da408a4@002 D@ 00@ R@ 0RPU X0 0j@c T @T, 00 -0L R 0S 0 R 0S 0SP  !202! !000!P6 -0L R 0S 0 R 0S 0SP  !20C2! !00C0!P6 -L3M!^ !AS@ Ð03 0   ! -LPpM 0`K⣃  TP @K 0  ?0S<Pi4P -LP`M 0ᣓ"P0@K~ p DXPP  0 P00S pܥ/p\ -L@$0 7R07 = 0S000D0 $ 0P*01   L/ - 7L  $0D0$ !000L/ 0-@PL$ 0\ 0 0v00 D 0l0  `jPH0D00@ 00D 0 t 000| 0i4 8$j4// p-@`L!0P  B0S0S  0S0S  10S0D0piv00 nv  v0t 0Dt0p0 TP0D0pPU< 00DPp`0D0p 80080 0@P``?@T/0? /@T冧D@ l! 00 0H Pp `V 0S d\ R0 h`V P` 00C 0V\ ?̐XR0cD@tpT@!0 0 H ϕ0wP`?@T/0? / ?R?  @$@" 8u4t4t4 u4s4p7s4Du40 0l@0 D p0@00 YTL@ hu4s4`V @pK0@0 @V@1@@#@0 t 0P?`V0?@T'0 /?֦ꔅ7u4u4 -D 0L0 040 \ ?0// 00C 0p7 -Lp 0 宦뤀`P 00 0Q  0 ^A0PE 00C 0U 0 Hᒦ@~P0pS.p 8$v4R6p7Lv4 -LPM0 0p tBTn6 8tv4v4?0?S0  /R` 0 /0 M 00C 00 lC0 X /0!0 6DP 0 R !p7R6 v4v4v4 p-`MBLT6 P0 0 /0!0  \0  RP?P0? @0RX  8w4v4p7H?j0? 00C 0DP 0 R 㭚p p-@LQ3 bV0 ? -'0 d0 R C R$:0  /P ?P0? @0R 00C 00 D0S  R XD!qpp7 0-PLQ. ? +'0 d0RC0R01P:|0  /@ ?P0? @0R\ 00C 0DP 0 R !90鸐p7 0-@PLU 0m@0  4044 U Qm00 t 10 8\w40w4Tw4 0-@ PLϕ\ \ d0  X'3@ 000t?SO0P0 8hw4 p-@P`L0  0 ?00?j000S 0S ? p  B!<4<!4"<0P p 8w4 -L tM p?0?p 0c0Y0 @mڜ@Tj@i 2< ,0 l 0D0  @  B4 0 8 m0?`S  DPK KR80b0C80  R08 0`0 \000 * 80\: @ 3 0 3?DK D=?0 @P 3 0T0 0 3?A0  ~Uku ou u u 0 P?jPPef@T?p0TL* @0p QD*0  a 0L0 @  2S f'|0; 08kt@ ot 1 t t ,p@ 00 0? @0t 00C 0*&?# @@ 8q4q4w4p7`0  T L0t0U0 ?S S@0? 8w4/ p-@P`L<0  0H0 000t p 8w4 -PL0Z`  0 4 80ģ@ 00 0&pWtt0Sh00 0 X寣P 0  00C 0   ឣ 8 x4p7 Ô03 0   !p؅7 84 -L`1!^ !AaK @Pp@  0@TQ ``P00C0 t0!^ !AaK`! !aLR6 87܅74Ԃ4D/@R64hR6 -L!^ !AaKp!pAp0P@ \\1 娙0S 0CS0?0a,$1`ᚙP0@2 咙/  M?@000@ 候0S 0@ x0S0!3.2> Ô03 0   !! !PaLR6 8܅7(47D4h444@R6 -@0 MPLU) ,C 0 pS 0 S``؅7Ѓ4{4X`X$ 7, t@`@DH PW(444 -L`pP@M X T ``pGHPh 0h d0l000? !,1R0!<1R 70708090 : 0C0R ``W !000!@@0 0' ,0 @ l Иx/؅7ԅ7 8Ԁ4 - 0LS1P |R6 -0LS$!0S00|R6 -LP@(01S00|R6 -40L  -L@ L 00$07 -p40L`H V`1@PP 00PQx/ p-LP`0  S 1@T 0S 0 0bS00PP@T R t0PR Yd l0 04 0S '@U0   $ p 8ȅ47J4 - L0 !00 0 007 -L@p@`=?0 !@0$  aRQP@T 040P 00T40@P 0 0T 7J -001 LR Q  00R Q00 0-L@P(0  40套0 84 0-@0PL@ 0 440 吗P0 0000 84 p-LP`@40  40$ v40p 844 -L@d0  X0 004 ^0 R 0,00 0 000 8T47 p-L`@Q 0S 0C0 rPU D0R Y8 k P400S p,pJ4 p-@0`0PL80  ,40 0000p 8t4 p-@0LP`@0  440 00'40 p 84 p-@0LP`80  ,40 00ޖ40$p 84 0-@0PL< 0 040 00Ɩ40 0 8Ԇ4 -L@L0  @0 004 孖0P 008#80 84 -L00S 0  -L\0  P化8R@P 0(0 , (0( 40  8p4R6  -L@(0  jl 84 -L'P 0000=?0 !  -LR -L -0  0  L - 00L -0L,$,!$#L <"0,$,!$# Ȉ44 -L\0  P8@P 0(0 , (0( 04 p 8`4pR6 -L@(0  h 84 -L@0  =?0 0!ѕ`P( 000@0 00000C 0? 1@00! ,10^ࠣ<1\0 @Q !0\0\ 0 1 84 p-L`@Pd0  X ᓕ`Y P @P00@00P0 00 pp 84 -L -L@@& ? 1R  01R ,1R <1R @^ࠣ\ @Q 1 Q\0 S 0S 0S0S 0s   -Lpp4p02p`2PL<4<,4!<0pD@H<4<,4$<0 0`8H@@pU P 0S p<4<("4 <0p<4<("4!<0p<4<("4!<0p<4<("4!<0@p 0s p \<4<("4!<0 1s dhpB! B<4<!4"<@0<4<("4 < 00  7Q -0000  L -L0,$,!$#QX匔0,$,!$#Q!1 0,0 x$4@4 -LP`p (@P (HP00V 0:0p 0 $0 -L@x0   l0 D0S 0CS0<9 P q( 84،4 0-L@PP  00%! 0P<000 -@L00 -L pkP|@P$ kkH`>ai/  nP hP P 000 P ZpPp 0-L@ PP P U m0 -Lp(MP"hD0   8804 W V=?0@ 8$44 4@ 0T*0!R  0$K2 PV $0S V0!-? 32>@ Ò03 0! -LP#M `NO0Q,0 D!00D!0s00D!00<4DPP 00D?`R @`200"4 2Su0S 0Y0R0S 2w#$(,"(M0S@BP 00 0 00 P 00C 0     84Ȗ4p74 -Lp`PM !0  0  000@ $Ġ Ƞ̌,Ƞ ̊0V0V@@T Ê4V $0KB( P*U $0 P( V$0$P( ( K$0PP  8$4T40  (a⏊$#(ꀗ4 -L@1   ~0 "402 00 0  0S S 0 R R0S 00C 000$  0 T 0 0S  00C 0$ 0 $ S ;> 84p74 p-L`@("XMH0   <+0 2K%48<#8$ ( K2K3 84p -L0P0p`10C,$,18#$!L`0  TTD01S80 (@ <8 8 8\4R68 -LP 1P R6 -LP 01R6 -L@0N0CS00 0S 0  尉0  0S!01P l0  h圉d0 , 0 D14 01D000D!D!000Ė8 8x48408 -LpN_@(@T Z1 0,$,!$#, "@\Q0D @SNJ <4<("4!<0<4<("4!<0<4<("4!̃\40D @S1J ^ *4`0,$,!$#,!^ ^:^ 01 0n RQ X0  @101 0 000 000Ė8088 -L0@M40 ,`0` 80,0 (  P 0  00,0  "2p < 0#0 0  P p`P 4K  " 84@A0 0<0 000 D  -LPM, ( `$` prK@d0   `P 0娈LPKC @ P  8 4\K00, K  0K0 psP2[S  0-@PL0  | 3y0S0D0#R 00D 3#$(,0"(#" 0<0 0v0 8\4 -L`p84M#HdP0   P0@G03K<8K80 40 (P 0  8  844̛4H` Dp @ TCK00X0 HK XKP  0    4 0-L@ M2PP o0$"<0 0@Pn|S6 0E0 00 -L -LPp`M0  00PP<4<("4!<0@P<4<("4!<0Pl <4<("4!<0 p<4<0 8@4 -0L # -0L # 0-0PLU$0 P Ġx0x Pp0p D@d0d T0T PL0L @D0D 0S68(88<888ȏ88Ė88 88$808ď8 8 0-LP@ 0#1<4<!4"<0@o:0 0-LP0 #LT  X:00 -L0,$,!$#  P 0-L@P%Q01@<4<,4"<0):0 0-LP@s? 0 -L`p Ġ̌.Č \URP@@F :00@ -L`P@V@ pETLÆ d90T `FPd9V餜4 p-L`P@@TV0T*T d ;@S ;0@c`FPETVp -LM, @@ 0  40 0xB  0P pBP0 R"* 0AT  0p`B0PW *`0p0 `SB0PW: 00P0 R:0 R,0004 PcU, 00 00(4<4L4X44 -LM, @D 0  40 0B0 0 P 0 0 BP 0 R*0aV @T 0pAp @A0PW: 00P 0 R:0 R,0004 PcU, 00 00(4\4L4X44 0-P0L@B@0   4,0 mP 04P800 8p4S6,I0 - 0LnS6 0-P0L@@0   4ᜅ,0 mP 04P800 8p4S6J0 - 0LmS6 0-@0 L  0|,P@T ]mP$@0 84S64 -80 L  (d$ 0S m 84S64 p-0`PLU @] 0S$Pp7tT6 -@LP v007 -L PM ` @@Q   R00@QR -? 003QQD0 S0  @TTg T# 0 0 3R<K  :<0K< [@D1000C 0 B R0S 0  HT `@T 0 0S/{-}?p 0 0 3R +V60*"&4@Kh0\ \ 0 010 1=?0   03Q00 0003Q00 0003Q00<8@@8X 8#w  -LM, , 8 t8 #8S A  080 ,4  0,04A4 ,04P,P:#v P0 _ M?@0 0` 0 3 R 0h0*'  h0S<SS 7 0 0 3R0 0 0 3R000<8@8 0 0 3R0 0 0 3R0T00 0 PW00pp0S00 8Q 0, 84#?<8 -L0M0 8 #8S A  000 ,  0 ,0 A, : #v,@ @PS 0h0`0QVD:VV ?=?0    03^00 0003Q00 000 3R$70!<8@8=?0    03^00 0003Q00 0003QL0 070 @WppY00S  ,8 #?<8 -L6S< Sd6S < SR< SR< SU -L@ 6#:S#$`04`0D`0`0"@x@d0!X0!QB `0$40`0(0  `:#ŀ@<8@8 -Lp M&C(10S S ES( BHP$H0 h0:#6!SB 0@0H$HP 0h0 : #6SA 0@1X%X P`0,@Kh0 < :#6!SB 0P1@8<8 p-L@0 Ph00`S S S 0J$F 01J$FJ01$F0 `p@8<8 -L`("(ꇟ 0   \`K`Ss<P`T0K8KSo?pp@0`P`@K  0V U@0p``K```PK0K@ KpWPL0V0$P@U!@0P@0 p`P@K@KP`R`Q@0P``0S0@`@K  X<0pX @0W PPK =0   0-L@=  09CXcc@Pp0UP!W1U 0T 09CXcR@7W@0@  0g=0P404 -L P 21P*0 0 ,B @ p4 0-LPQ P0@LDL 5@d@ -LBDM@0 8 < \H A@PQD@ n @Q0+P@K _` Qc/ P@K _`` 0   0@HP!P@DP`K0@GBK(0K -L45ˠ  S \ R /\0@M4 0 K`lV008 P @8 ?V 3p f? 2  00@Ps`p p  0 5PPp`p p @00@p8000K4) p-LDE;PoUJP% tV 0T0U0S pp~UP L 000p5D "0a4  000VapV6 -LO ;0 MD S@0 P <@K1,/ O08P`$SP0@ @KD K@00C@0 0@ハDp >ᡡ@0偞=OjPp  p-L$%;0SP$M4 o00 R ,@K 0K9'@ 0K'''S R 0K '0K4 K4 D4 00  K-'"K,0Kp -L;P P 45S ~P&ʌ0 10 S / S S ~P45S RR0`p 0 AS0 S S?S S  P  000V6V6 -L@`;Pa^ àM$ p U\E kXQN2 0 ^ K 0 ^0n03  1>0Q006!Q P K84U2$0 n\$@K$0 \03  0<0P00U )U 1 $0A 2 $0 AB p-L`@;$%;Pe\M # C^ d`^PRT:P*:(1PRU R K&F^10 l^K0 ^0 3  0>0P00 01 0 `& 0K  B%^P !UL1 0 \ K 0 \0l03  1<V60Q00010 0K  CAp -L/R u -L/R i -LP;@`V;M0 /,@ ?8 "4 P0^0\0S XU \^ NK`"EATP ,K0 K40S8P24K8 K,40 `0 A< %80#0 54C80  ,1p W/`PP`00@s pP` 0J <0倐C  -LP;@T;M0 /,@ ?( p"$ ^ R\P K\P D\P @:4$K( K,0S0P),K0 K{,$00 c}%(00 5dV(` ~000 0 0P@2?,RS  c -LP;0 M8 S40 ;0 , ?<0 \0P0R0S rRP) kRP=,K0 K!40S8P 4K8 K4 ,08c\008 %0 /\8 400 |080 0 80RppW0b80 \8@0@ P#2@0 8 0l0s"!L0 0c80 [80"!0 #180 UR0b80 0@@L80 \@d P!0 @ pX@W@00@@0p>L0\ 7cPPu`@0 @ pX@W@ l@ /p@0@ LC0@ .c8 08 p0aS80 0S 8 800c80 ,<08 # -L ;0\M$  0 P KQH Q B f>S0P9 K$ KE 0$ %$0C0~p$ 0S"^ $< 0@ `P>PU`V$ N O0 0@P`VP   -L;0S@45S;0S45S   P 00  -L;0S45S;0S45S ?S S00  P *S S   -L;0S45S;0S45S ?S S 00   P *S S   -L;0S45S;0S45S  P 00  -L;0S@45S;0S45S OK a?S S00  P *S S   -L;0S@45S;0S45S  *?S S 00   P *S S   -L!:ʠB?p0KM@ʠ0K 0 R \ R0\40 0 K8  0p0B^l PU;0K?U   .p  e? >,  00@Ps`p p  0 /PPp`p p @00@p8 00K4L -L!:**?0CbFO0X@P 1R00@  !4X @00RS 000` `p-P@ZdYZ Z \ Z000 +PQ  000 V6 -L!:@**Rp00Kp M 0p00KB^b PU;00K40 ?U   _-p  e? +  00@Ps`p p  0 /PPp`p p @00@p4000K -L!:**?0CbFO0X@P 1R00@  !4X @00RS 000` `p,P@ZdYZ Z \ Z000 +PQ  000 V6 -L`P&:@リ᪪?xpDKt p$M0ZH0 D K 0S <@K ,,H0' ,`P* *  00@psP` P``D RZ !JJH ? -L`P&:HQP 0 Ki0K0@ e0KR  p, ?R  n)p  ? '@00@ Pq`p  0 0+PPp`p p @00@p0K0K8K0@0KLD ,pWD qX0HP 0 0   @K h  eLP PE V6@00Kp8 KP 00KU  p4 ?U   (p  e? )'  00@Ps`p p@  0 *PPp`p p @00@pPL0K0@0 KHpWAD0 @ -Lp`O@TM @@M -Lp`O@TM @<@ -LP@K|MppK邟T`K pK\ ( _":< 0K 0 @8 K p \<p@ ?@0#0d0 \0 K 0S 8 ^00 P0K`@K 0O0 ^!8pKP PK`K 00K 0O0dP O0P`\0K 00KRd0 @0@K< KN@0S8 0 dP0@@ K080K萀K< K蠀KpK~@ ᐀K!KᔀpK5p ᠀K阀%j0KU80K`` pt@ @Kp K⤐yt0i@0P HKL TPKက S $0 K`p`p@K`p@PK0@K 0 0PK 鐀XQ@0`p0K P @@K0`P P `00@ps   P` @00P U0 H0KLpK@Kd@K   -L`@KpMPK`` 銟pKd` Kl & _":@ ʠ0K 0 @8 K p l@ʠ< ?@0#0t0 ^0 KP `0Kp@K 8\ 8 40 - `PKp`K ,tO_` O0-\8K@ R ` Kp@K qtP0@\"8`K`PU0K0O0t O0pP`< K00K80K @0S0@K 00KR tP0@0`K@ K0K`莟  P `%K5 p * @0K @80K40x xP @PxP P@@PS 80S ?x`@`x` 0K0K0 K0 @KW/ 0SR0K|0`KP`\0P`pTHKPK S0@0`PK0@VU@0@K0K``KPU`w XX0K`(W&@0P`` 00KK`@0P`` ``0KXXK`W@0P``0S`P`@KK P`00@s 0@ P`0@tx@K 2 -L@KDM PK 鷟DPK  , _L ,:@ 0K   p 8KPŸ @  < @\P R0K 0S 84  P00 @ KPK  P 8K 0S> @ KPK P8K 0SM< K00K80K@0S 0K 0S00K 0K@ K@K @0K`S P `J5 p *0K\80K |@ K0K 00K4 ,00K` R8 00R  0 K0S@@L\-00K  0 K0 d Zd Y 0 00 >L0K\#!_$a9J$F$s 0@\50K0 K0 d ZdY @ ld $0 K#!$80Kd0 K L#9J$H$`PPU`00K` 0K!?"A `80K%!&p8K`0 K` Q 00K0S@00@T0  Y 0K``0SP 0Ks 00K0K \<, -L!:ʠʠ?v_` !P`^XM4 0 K`  0@K0S 0 4R2 R 0O0+ %&\ 0K 0S00K 4 K0PKE_`0 K40@ʠ@pGpXp 0@0 &:::S00@0  q ?0Q Q   O00WX VUQQ  -L40K$M@KH@K[ 4[^7L0 D0H0/L  L In7@T@@0KT  p3 ?T   J!p  d? t  00@Ps`p p  0 #PPp`p p @00@p@KL0 -L40KM@K`[In>@4[T㣧ʼ0^% O00?T P00^S | 000(p `PZeYZ Z  Z000V6 PQ  000 V6 -L4K p@0`K `K0@<0K\ ?8K`@P``@K ` P``\ `0K&[\' R =@?V6V6?R 8 K`K0@ $B` K0@$0K 0 3[L03K8 ,0R (0R 000 V6 -L4KXMh @pKHPK[PK9$[@  `bp Vl@ H8Z D0H0/hXKpPK0P`FV0f? p&?V p @Vp p0 PPp`p@00@pP K\ P1p@TPK/Sq pl 74Kh0Z`fYXK? @K0p&?Y p p@Yp p0 > PPp`p@00@p@ Kp0\0 .0Z@@KPK` O00 hs^h0ZX0K@ KPKd KZ\ Kd0Kv;\ @KPKdK0@` R+`KQ?  P0K0  :@p`Pp00@s P`pP`   `pX0K`d Kp\00\0 `KPK0 h\0l >hV6 -L4pKhMp LPK@KT`K[\K9x $[@ bt@ Y| ;8^P0K`@K` O00k<0K  $Kp0<x@Tx | p`d0KPXP T \0RQxT \0Ssx#0 S007\3|@TX0\0/ t |@0"74Kp0dKx@P K T`iV? 0p@?V  xp A3@Vp- V? 6p a@00@ Pq`pp0 PPp`p@00@p0P@K`KP0K0d0Kv `0Kl0KQ WV@0 t@|@$t@ 41xQP K/ pp0{dK|@`KTIY0i?`0pD?Y  p 7@Yp1 Y? p @00@ Pq`pV6p0 kPPp`p@00@p` KlK`0KP@K0d0Kx `VpYX@0`px` K0p0t 0pV6 0-L @K(MP,0K["[Ǡ\ 1 `0 0-L @K(MP,0K["[Ǡ\ F  0 -L4KxMx LK@KTpK4[0`0 d[\PK4[0d0 "`@4[T77#0 `|0 P0T0/!d0S0\0/ 0O0 |@7774KFd\%X0\0/ x/@00 w<0KKx0|@V74KTT@K0S|74K ` K0d0S\ 0 |@74Kx0}d K0`K @ lK>@ K`0p ᑓ%p0Q᐀ t K0 P (0K@K@0pK0@XW@0@Kh0Sl0S pKp0KA 0It0K CP@? @Pl0K0pKpK0x0| 0^xV6 -L4KM LK@KTpK4[ 0d0 d[\PK4[ 0`0 !d@4[T77#0 `0 P0T0/`0SX0\0/( PR74KH`0SX0\0/ @72S'\PK(0SPK/@00 W<0KK0uK@p7<04K` K@\0Kd0ST P0 P74K 0Ud KP@KT0KKdPK"A0 0\@K TPK > P\ T0RP`KX0?  kp` 4K T0K`@KP KPK `K\K0`KP`\0P`pTlKtK S?@0`P@K  0V U@0`K``PKKpK`K @ 00S@pW V|0K# U!@0p`K@0K` KP```0K|K X` W@0P``0S`K K0 >0K@P0/RQ`K`K0 KP` \0P`pTS0@0`PK0@V U@0@KpPK`KKps Q T$S"@0 K`K@0  `K@0pT K`S@0P``0S`PK@KKP` 00@s 0@ P`0@0 @K 0`K``oV6 -L4KM L0K@K TK[y d 輄[P0\`K0d@[ ` 訇ßpᔀ TPP0T0/`0 S#X0\0/ `0SX0\0/ o0kS\@K0S t<0KK0X` K@\0Kd0SP0T0/PEd KP`KT0K`Km\K0@ PKd KA@0 Qq`&X?  PK0 p` \ KT0K0\@KTPK @0PKQ\ T0R0 @K P`P PK`KTK0S@l K t0K0 |@K@ @AQ ``K``PK@K PKQ P K@00@@0 K0`K`KP` \0P`pTS~?@0`P@K  0V U@0PK``` K@K PK@0P K @K K0S@@K R 0 PTK U QK`@0P`` K> P0K0`K> >L P@ K 0@PST0K0gʈ@@@T@ ``K``PK@K PKQ P0K @@d rPK` `K0Pᗀc0 T S?`p@K`p@0  RQ@0`pPP K @K PK Q PKQ TK TSPK@0 `K` K Z  j? 0`P@0 TK% @K K` P `` `KQ KQ VT0KU@K Q ``TSQR0V U0 P P@0` K @ 0PK K`ppW 0S @R| KQP 0@`PKTSQR0Q R0 P0PPKQR`0WX00 K@00@S 0PPK@KPP%P PK `0PK00`P0 -L4KM L`K@pKTK4[88X0 !XP4[PᣇP0T0/ SX0X P@K0O0P<0KK0PT@K0S4K0X KP@KT0K9XPPK0@?L 1 0@K p``KKP OX ?T0K R=>0?X  p` ?KP K`@K >@K 0 PK@0 R0 @K ``PK PK0`0K `P> P`pK @K0s0 p  T0KpK`\hK^0@0p@K  0X W@0 KP0K`@K`KpK`K@00S@YVx0KBU@@0pK9PK@0 p QpKK? ` Kp0K0@P0 K pK p0Kh0K0K`px0K^P t0S? K p0K0 P@ PK0 0 0gpK0/Rx QuPK00@s 0@@00@ 0 㐜Ss<P`TKS?pp@0`P V U@0p`K 0pK뀠K p? u`PP`p0K` KK K0y@PZY@0 K0咒Ss@0P` TS>pp@0`P V U@0p0KKK0K0K K t KKUT0`PPU`XW p K 8 K0 2 K , K0 & K @ 0 @K!#$K0l 1#$K0X 1001 K K 0Ku0 !@8@pW 0 0h 0@8 p-L`PM $@K!\3h 0S S 9S 6$ K0@ $K 01 @>01$K @ !2("(h00S S S 00Kd 010K010KH":Q#VP B Ql  Qb Q' Q, Qe Q. }Q3 Qc x Q Q; 1Q` nQ< k Q1  Q& e1QL Qa _<@K0KLH@K0K5DT@K0K <00K`@K4l@K0K9,00Kx@K1$@K0K0!2[h9#2K2[T882K @K@K01@8@`V 0 0h 0@8p`@Є\@ @OFunction entered at [<%p>] from [<%p>] r%d = %08X%c vK:@K:J5*   % P1P1P1P1P1P1P1P* 02 !! "! !-@  QBJ0#(  p-x    x    L< p 0L < 0 l<3, -LR7  RČ 00,Ġ;0 0000L<   @P000 @@0  @ 8@$D@$D@@02 RČ 0  0R@\4 j$D0 L%T\&dl't|0000(DL<   P`L%T\000&D PL@0%D   8@$D@$D$H0 H%XX&hh'xx0000(HL<   P`H%XX000&H PH@0%H  ~ 8@$D@ @u$L0 D%\T&ld'|t0000(LL<   P`D%\T000&L PD@0%L  G 8@@@<$D@ -LR:  RČ 00,Ġ>0 @P`p0000L<   @P000 @@0  @ 8@$D@$D@@02 RČ 0  0R@\7 p$D0 P`pL%T\&dl't|0000(DL<   P`L%T\000&D PL@0%D   8@$D@$D$H0 P`pH%XX&hh'xx0000(HL<   P`H%XX000&H PH@0%H  x 8@$D@ @o$L0 P`pD%\T&ld'|t0000(LL<   P`D%\T000&L PD@0%L  > 8@@@<$D7 02 !! ! !@-@ PPPPPPP RPP 103  R: 10#3<    20 1@ 03  RZ@ -LQ: R$. R R Rrxx B 88 R  R0000 B  R0@ѤP0@Pl\0@ѤP0@P R p\2 R B'4<$DL%T\&dlx R '4p R<0A R B'88$HH%XX&hhx R '8p R80A R B'<4$LD%\T&ldx R '<p R40A R#, R  R1 Rrx1x  B 818 B  R01010 0  B  R0q@qPq0`@`P`\0q@qPq0`@`P` R 0\2 R Btx1&|d%lT$\D#L  R Ġ01 R#̌  R Bxx1&xh%hX$XH#H  R Ƞ01 R#Ȍ  R B|x1&tl%d\$TL#D  R ̠01 R#Č  RS 00R-@ R P P P P  P P P QS    0Q-@Q P P P P  P P P      02 !! ! ! R0TJ03A A 03 Q@ 222@0 2020 ! #" !0 ! # !0 ! # !l\000Ѥ000 B@-R,, RBJ00ʠl,ʰ R B \xxxx \Z|xx00 < \000Ѥ000p\h3  RB&J'4p<0ʠl,ʰ R B\ '4<$DL%T\&dlx\Z'4<$DL'4p<0 '4< \0#40#40 RB&J'8p80ʠl,ʰ R B\ '88$HH%XX&hhx\Z'88$HH'8p80 '8< \0#4000Đ RB&J'<p40ʠl,ʰ R B\ '<4$LD%\T&ldx\Z'<4$LD'<p40 '<P8#8 XU*@P*U@2P0b 8#&Ƞ ( Ȍ"!Ȭ\00S^ ^0S  R 1<108   0(ЍQ& 0P1QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!"l!-g  ( P         0                           x y z { | } ~  @ ` ` ` pS `$ $ $ ;) E) O) ) ) ) - 0S: 0: 0 : : g= ? ? ? @ %@ C@ x@ @ @ @ @ @ A VA G 'H J 7J 0N IO 0O O Q lQ Q R @R 9S S @S IT T @ U dU U U 0U U V !V 2V PQV ^V jV `V V @W ` ^ ^ 4^ `d^ y^ ^ uu u 㲤 㼤 㼻 0U @< b C   U `l 0l 0s  0 0  q P P  0                              0 0 0 0 0 0 0 *+ @B `PBB B PB @㺗  ` K v @ɿ Pd 0p  @> q @} @ P  P9 `F 0i    P3 0 0@R 0P] 0@h v @% @P @P @P @P  0C 0 `    `V i 0 %         U t * `6 M Y `e `q `} @  0 6      g v 0            6 7 7 7 '7 A7 M7 Y7 g7 y7 7 7 7 7 7 @aQ 0Q `9 V Х ڥ a f ㎩ pPЪ 㣫  õ ҵ ߵ @  e u @ ]  @  `O P `P yP 7T QT Lm mm @p  2 0 i ٳ 0 00 08 0M 0V 0_ 㿵     " 0i 0〶 0㉶ 0㗶 0㠶     $ @P@ 02000   @@Q@- J@- @- @- +@- :; !00S0!X:@- :\ !04S0!:@-  /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hpers_to_level()/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/raid/md_k.hinitTERM=linuxHOME=/jsfdddvapblockflashpfpcdpddpdcpdbpdaedbedasbpcdgscdcm206cdaztcdsonycdcdu535mcdscdramxdbxdamdfdadeaddadcadbadasdpsdosdnsdmsdlsdksdjsdisdhsdgsdfsdesddsdcsdbsdahdthdshdrhdqhdphdohdnhdmhdlhdkhdjhdihdhhdghdfhdehddhdchdbhdanfs/dev/Calibrating delay loop... %lu.%02lu BogoMIPS init=Kernel command line: %s POSIX conformance testing by UNIFIX /dev/consoleWarning: unable to open an initial console. /sbin/init/etc/init/bin/init/bin/shNo init found. Try passing init= option to kernel.Linux version 2.4.0-test10-rmk2-np3 (slatham@suo14) (gcc version 2.95.2 19991030 (2.95.3 prerelease/franzo)) #17 Wed Dec 20 12:25:13 EST 2000 /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h%2d: %14s %s <3>dma: error trying to allocate DMA%d <3>dma%d: freeing active DMA <3>dma%d: trying to free free DMA <3>dma: trying to free DMA%d <3>dma%d: altering DMA address while DMA active <3>dma%d: altering DMA count while DMA active <3>dma%d: altering DMA mode while DMA active <3>dma%d: trying to enable free DMA dma.c<3>dma%d: trying to disable free DMA <3>dma%d: trying to set_dma_page /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.htimer/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.harch_request_dma() allocating dma channel %d arch_free_dma: invalid channel %d arch_get_dma_residue: invalid channel %d arch_disable_dma: invalid channel %d generic/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hGPIO 11-27SA1111Neponset%3d: %10u %s, %sErr: %10lu <3>IRQ LOCK: IRQ%d is locking the system, disabled <3>IRQ: spurious interrupt %d <3>Trying to free IRQ%d <3>Trying to free free IRQ%d /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hReboot failed -- System halted pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%ckerneluser IRQs %s FIQs %s Mode %s%s Segment %s onoff (T)Control: %04X Table: %08X DAC: %08X f%d(%c): %08lx %08lx %08lx%cFPSR: %08lx FPCR: %08lx /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>add_breakpoint: too many breakpoints ptrace_cancel_bpt: bogus nsaved: %d! <3>ptrace_cancel_bpt: weirdness /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsemaphore.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hKernel dataKernel codeVideo RAMreservedCPU configuration botched (ID %08x), unable to continue. Processor: %s %s revision %d %s%cArchitecture configuration botched (nr %d), unable to continue. Architecture: %s <4>Using compatibility code scheduled for removal in v%d.%d.%d mem=System RAMs<4>Warning: bad configuration page, trying to continue Processor : %s %s rev %d (%s) BogoMIPS : %lu.%02lu Hardware : %s Revision : %04x Serial : %08x%08x /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hSYS_32UK14_32UK13_32UK12_32UND_32UK10_32UK9_32UK8_32ABT_32UK6_32UK5_32UK4_32SVC_32IRQ_32FIQ_32USER_32UK15_26UK14_26UK13_26UK12_26UK11_26UK10_26UK9_26UK8_26UK7_26UK6_26UK5_26UK4_26SVC_26IRQ_26FIQ_26USER_26interruptaddress exceptiondata abortprefetch abort%08lx: %08lx Code: (%08lx) pc not in code space Internal error: %s: %x CPU: %d Process %s (pid: %d, stackpage=%08lx) Stack: invalid kernel stack pointer %08lxkernel stack pointer underflowBacktrace: no frame pointerinvalid frame pointer %08lxframe pointer underflow<6>%s (%d): undefined instruction: pc=%08lx Oops - undefined instruction<6>%s (%d): address exception: pc=%08lx Oops - address exceptionHmm. Unexpected FIQ received, but trying to continue You may have a hardware problem... <2>Bad mode in %s handler detected: mode %s <2>Vectors: <2>Stubs: Oopsbranch through zero[%d] %s: arm syscall %d <3>[%d] %s: obsolete system call %08x. xchg: bad data size: pc 0x%p, ptr 0x%p, size %d traps.c*pgd = %08lx, *pmd = %08lx, *pte = %08lxunknown data abort code<2>kernel BUG at %s:%d!<2> - extra data = %p%s called, but not implemented%s:%d: bad pte %08lx. %s:%d: bad pmd %08lx. %s:%d: bad pgd %08lx. Division by zero in kernel. <2>abort() called from %p! (Please report to rmk@arm.linux.org.uk) Oops failed to kill thread/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<1>pgd = %p <1>*pgd = %08lx(bad), *pmd = %08lx, *pte = %08lx, *ppte = %08lx VM: killing process %s <7>%s: unhandled page fault at pc=0x%08lx, lr=0x%08lx (bad address=0x%08lx, code %d) <1>Unable to handle kernel %s at virtual address %08lx NULL pointer dereferencepaging requestOopsUser: %li System: %li Skipped: %li Half: %li Word: %li Multi: %li sys/debug/alignment<3>Unaligned trap: not handling swp instruction <3>LDRHSTRH: PC = %08lx, instr = %08x, addr = %08lx, eaddr = %08lx Alignment trap: not handling instruction %08X at %08lX<3>Not handling ldrt/strt correctly <3>LDRSTR: PC = %08lx, instr = %08x, addr = %08lx, eaddr = %08lx Alignment trap: not handling LDM with s-bit <3>LDMSTM: PC = %08lx, instr = %08x, addr = %08lx, eaddr = %08lx %s: permission fault on section, address=0x%08lx, code %d 1!1 |1!1`1! T1`1! T141 $141 $11! 11! а1page permission faultsection permission faultexternal abort on translationdomain faultexternal abort on non-linefetchpage faultexternal abort on linefetchterminal exceptionalignment exceptionvector exception<1>Unhandled fault: %s (%X) at 0x%08lx <7>Weird data abort detected /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hinit.cMem-info: Free swap: %6dkB %d pages of RAM %d free pages %d reserved pages %d pages shared %d pages swap cached %ld page tables cached Freeing %s memory: %dK <6>Memory: %ldMB = %luMB total <5>Memory: %luKB available (%dK code, %dK data, %dK init) init/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hmm-armv.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsmall_page.cTrying to free non-small page from %p Trying to free free small page from %p /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hconsistent.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hremap_area_pte: page already exists /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<6>SA-1111 Microprocessor Companion Chip: silicon revision %lx, metal revision %lx <3>Could not detect SA-1111! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hSA-1100%2d: %s <3>%s: no free DMA channel available <3>%s: unable to request IRQ %d for DMA channel %d <3>Trying to free free DMA%d /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value set_timer2, when: 0x%lx, now: 0x%lx OST2 - gpIRQ initialization failed! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<4>Warning: SAC xfers below %u bytes may be buggy! (%u bytes) <4>Warning: DMA address %08x is buggy! <3>%s: invalid SA-1111 SAC DMA channel (%d) <3>%s: SA-1111 SAC DMA channel %d in use <3>%s: unable to request IRQ %d for DMA channel %d (A) <3>%s: unable to request IRQ %d for DMA channel %d (B) <3>%s(): invalid SMCR DRAC value 0%o sa1111_check_dma_bug/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.hNeponset expansion board detected panic=1Intel-Assabet/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsigqueuesignals_init(): cannot create sigqueue SLAB cache<7>eh? notify_parent with state %ld? /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<0>Restarting system. <0>System halted. <0>Power down. <0>Restarting system with command '%s'. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.heventd/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>schedule_timeout: wrong timeout value %lx from %p sched.cScheduling in interrupt WTZDSR%-8s current %08lX %5lu %5d %6d %5d (L-TLB) (NOTLB) %7d %5d sig: %d %s %s : %d X free sibling task PC stack pid father child younger older UGH! (%d:%d) was on the runqueue, removing. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hfork.csignal_actCannot create signal action SLAB cachefiles_cacheCannot create files SLAB cachefs_cacheCannot create fs_struct SLAB cachevm_area_structvma_init: Cannot alloc vm_area_struct SLAB cachemm_structvma_init: Cannot alloc mm_struct SLAB cache/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hLinux<3>No execution domain for personality 0x%02lx %d-%d %-16s [%s] kernel/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<0>Kernel panic: %s <0>In interrupt handler - not syncing <0>In idle task - not syncing <0>Rebooting in %d seconds../opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.httyS/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>init_module: Invalid module header size. <3>A new version of the modutils is likely needed. <3>init_module: Size of initialized module exceeds size of created module. <3>init_module: mod->name out of bounds. <3>init_module: mod->syms out of bounds. <3>init_module: mod->deps out of bounds. <3>init_module: mod->init out of bounds. <3>init_module: mod->cleanup out of bounds. <3>init_module: mod->ex_table_* invalid. <3>init_module: mod->flags invalid. <3>init_module: mod->can_unload out of bounds. <3>init_module: changed module name to `%s' from `%s' <3>init_module: self-referential dependency in mod->deps. <3>init_module: found dependency that is (no longer?) a module. %8lu%4ld (deleted) (autoclean) (unused) (initializing) (uninitialized) [ ] %0*lx %s [%s] %0*lx %s /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.htask releasing itself exit.cAiee, killing interrupt handler Attempted to kill the idle task!Attempted to kill init!/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hAttempt to kill tasklet from interrupt /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hPCI IOPCI mem %08lx-%08lx : %s %04lx-%04lx : %s check-regionTrying to free nonexistent resource <%04lx-%04lx> reserved/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hdevdebugfsprocnetvmkerneloverflowgidoverflowuidrandomthreads-maxsysrqsemmsgmnbmsgmnimsgmaxshmmaxrtsig-maxrtsig-nrprintkctrl-alt-delcap-boundpanicdomainnamehostnameversionosreleaseostypepage-clusterpagetable_cachekswapdpagecachebuffermemovercommit_memorybdflushfreepageslease-break-timedir-notify-enableleases-enabledentry-statedquot-maxdquot-nrsuper-maxsuper-nrfile-maxfile-nrinode-stateinode-nr<4>SYSCTL: Can't register %s <1>Help - malformed sysctl tree on free %d%lu/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.hptrace.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h 66666bug: kernel timer added twice at %p. <5>Clock: inserting leap second 23:59:60 UTC <5>Clock: deleting leap second 23:59:59 UTC /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.huid_cacheCannot create uid taskcount SLAB cache /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hmemory.cforget_pte: old mapping existed! <6>Mapped page missing [%d] do_wp_page: bogus page at address %08lx (page 0x%lx) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hfind_vma_prev: tree inconsistent with list exit_mmap: map count is %d insert_vm_struct: tree inconsistent with list /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hfilemap.cweirdness: pgoff=%lu index=%lu address=%lu vm_start=%lu vm_pgoff=%lu Page-cache hash table entries: %d (order: %ld, %ld bytes) Failed to allocate page hash table /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hmprotect.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hmremap.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hvmalloc.c<2>Whee.. Swapped out page in kernel page table <3>alloc_area_pte: page already exists <3>Trying to vfree() bad address (%p) <3>Trying to vfree() nonexistent vm area (%p) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hslab.csize-%Zdsize-%Zd(DMA)<3>kmem_create: %sForcing size word alignment - %s kmem_cache_create: couldn't create cache %s. <3>kmem_cache_destroy: Can't free all objects %p slabinfo - version: 1.1 %-17s %6lu %6lu %6u %4lu %4lu %4u /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hbootmem.chm, page %08lx reserved twice. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hswap.cVM: __lru_cache_del, found unknown page ?! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hvmscan.cVM: reclaim_page, wrong page on list. <3>VM: reclaim_page, found unknown page VM: reclaim_page, found page with count %d! VM: page_launder, wrong page on list. VM: refill_inactive, wrong page on list. kswapdkreclaimdStarting kswapd v1.8 /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hrw_swap_page: bad swap file <3>rw_swap_page: page unused while waiting! page_io.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hHighMemNormalDMApage_alloc.c<3>__alloc_pages: %lu-order allocation failed. Free pages: %6dkB (%6dkB HighMem) ( Active: %d, inactive_dirty: %d, inactive_clean: %d, free: %d (%d %d %d) ) %lu*%lukB = %lukB) On node %d totalpages: %lu zone(%lu): %lu pages. setup_mem_frac: %d /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hSwap cache: add %ld, delete %ld, find %ld/%ld swap_state.c<3>VM: Found a non-swapper swap page! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h<3>get_swap_page: bad count %hd from %p swap_free: Trying to free nonexistent swap-page swap_free: Trying to free swap from unused swap-device swap_free: offset exceeds max VM: Bad swap entry %08lx <3>VM: Bad count %hd current count %hd swapfile.cVM: Undead swap entry %08lx Filename Type Size Used Priority %-31s file partition %d %d %d Unable to start swapping: out of memory :-) SWAP-SPACESWAPSPACE2Unable to find swap-space signature <4>Unable to handle swap header version %d <4>Swap area shorter than signature indicates <4>Empty swap-file <6>Adding Swap: %dk swap-space (priority %d) VM: swap entry overflow Bad swap file entry %08lx Bad swap offset entry %08lx Unused swap offset entry in swap_dup %08lx <3>swap_count: null entry! Unused swap offset entry in swap_count %08lx Internal error: bad swap-device rw_swap_page: weirdness <3>rw_swap_page: Trying to swap to unused swap-device <3>rw_swap_page: no swap file or device /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hOut of memory and no killable processes... <3>Out of Memory: Killed process %d (%s)./opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hchown_common: NULL inode get_unused_fd: slot %d not NULL! VFS: Close: file count is 0 /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hCharacter devices: %3d %s %02x:%02xunknown-char%s(%d,%d)<7>init_special_inode: bogus imode (%o) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hVFS: filp allocation failed VFS: file-max limit %d reached /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hInvalid blocksize passed to set_blocksize<4>set_blocksize: dev %s buffer_dirty %lu size %hu <4>set_blocksize: b_count %d, dev %s, block %lu, from %p buffer.cVFS: brelse: Trying to free free buffer brw_kiovec: iobuf not initialisedbrw_page: page not locked for I/OVFS: grow_buffers: size = %d Buffer memory: %6dkB Buffer-cache hash table entries: %d (order: %d, %ld bytes) Failed to allocate buffer hash table kflushdkupdate/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.h%s %s nodev,nodiratime,noatime,mand,sync,nodev,nosuid,noexec,broken_suid,lock,nolock,noac,nocto,udp,tcp,posix,intr,hard,softnone %srorwnfs,v%d,rsize=%d,wsize=%d,acregmin=%d,acregmax=%d,acdirmin=%d,acdirmax=%d,addr= 0 0 # truncated VFS: empty superblock %p locked! VFS: put_unnamed_dev: freeing unused device %s super.cVFS: Busy inodes after unmount. Self-destruct in 5 seconds. Have a nice day... <3>VFS: Unable to mount root fs via NFS, trying floppy. I have no root and I want to screammount_root: unable to allocate root deviceVFS: Cannot open root device "%s" or %s Please append a correct "root=" boot option VFS: Unable to mount root fs on %sVFS: Mounted root (%s filesystem)%s. readonlyroot/dev//dev/rootVFS: add_vfsmnt failed for root fs/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hbdev_cacheCannot create bdev_cache SLAB cacheblock_dev.c Block devices: %3d %s <7>VFS: Disk change detected on device %s VFS: busy inodes on changed media. unknown-block%s(%d,%d)/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hVFS: Warning: %s using old stat() call. Recompile your binary. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hmem_map disagrees with %p at %08lx exec.ccore./opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hpipe.c[%lu]pipe:h<2pipefs/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.husr/gnemul/bsd//opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hfcntl.c<3>kill_fasync: bad magic number in fasync_struct! fasync cachecannot create fasync slab cache/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h.../opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hlocks.cAttempting to free lock with active wait queueAttempting to free lock with active block listAttempting to free lock on active lock list<3>locks_insert_block: removing duplicated lock (pid=%d %Ld-%Ld type=%d) locks_delete_lock: fasync == %p locks_conflict(): impossible lock type - %d <4>lease timed out %d:%s %6s %s ACCESSPOSIX MANDATORYADVISORY *NOINODE*FLOCK MSNFS FLOCK ADVISORY LEASE MANDATORY UNKNOWN UNKNOWN %s RW READ WRITENONE %d %s:%ld %Ld EOF %08lx %08lx %08lx %08lx %08lx ->file lock cachecannot create file lock slab cache/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hdcache.c/,M2<4>VFS: moving negative dcache entry (deleted)dentry_cacheCannot create dentry cacheDentry-cache hash table entries: %d (order: %ld, %ld bytes) Failed to allocate dcache hash table buffer_headCannot create buffer head SLAB cachenames_cacheCannot create names SLAB cachefilpCannot create filp SLAB cache/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hwrite_inode_now: no super block inode.cInode-cache hash table entries: %d (order: %ld, %ld bytes) Failed to allocate inode hash table inode_cachecannot create inode slab cache/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hattr.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>free_fd_arrayarray = 0 (num = %d) <3>free_fdsetarray = 0 (num = %d) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hkiobufCannot create kernel iobuf cache /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>__inode_dir_notify: bad magic number in dnotify_struct! dnotify cachecannot create dnotify slab cache/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hELF/usr/lib/libc.so.1/usr/lib/ld.so.1<4>ELF: Ambiguous type, using ELF %d<3>Unable to load interpreter COREsizeof(elf_gregset_t) (%ld) != sizeof(struct pt_regs) (%ld) RSDZTDelf_core_dump: file->f_pos (%ld) != offset (%ld) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hproc/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hde_put: entry %s already free! de_put: deferred delete of %s ,uidgidproc_iget: using deleted entry %s, count=%d proc_read_super: get root inode failed /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hnetsysvipcsysfsdriverbus/proc/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hexerootcwdmemmapsstatmstatcmdlinestatusenvironfd...procfs: impossible type (%d)%dself/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h...remove_proc_entry: %s/%s busy, count=%d /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hName: W (paging)T (stopped)Z (zombie)D (disk sleep)S (sleeping)R (running)State: %s Pid: %d PPid: %d TracerPid: %d Uid: %d %d %d %d Gid: %d %d %d %d FDSize: %d Groups: %d VmSize: %8lu kB VmLck: %8lu kB VmRSS: %8lu kB VmData: %8lu kB VmStk: %8lu kB VmExe: %8lu kB VmLib: %8lu kB SigPnd: SigBlk: SigIgn: SigCgt: CapInh: %016x CapPrm: %016x CapEff: %016x %d (%s) %c %d %d %d %d %d %lu %lu %lu %lu %lu %lu %lu %ld %ld %ld %ld %ld %ld %lu %lu %ld %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %lu %d %d array.c%d %d %d %d %d %d %d %08lx-%08lx %s %08lx %s %lu/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h%d-%d%dsystem:/dev/ttysystem:consolesystem:vtmastersystemconsoleserial:calloutserialpty:masterpty:slaveptytype:%d.%d%-20s /dev/%-8s %3d %7s %s unknown%-10s %2d ???ttytty/ldisctty/drivertty/ldiscstty/drivers/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h%d.%02d %d.%02d %d.%02d %d/%d %d %lu.%02lu %lu.%02lu total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8u Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8u kB Active: %8u kB Inact_dirty: %8u kB Inact_clean: %8u kB Inact_target: %8lu kB HighTotal: %8lu kB HighFree: %8lu kB LowTotal: %8lu kB LowFree: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB cpu %u %u %u %lu cpu%d %u %u %u %lu page %u %u swap %u %u intr %u %u disk_io: (%u,%u):(%u,%u,%u,%u,%u) ctxt %u btime %lu processes %lu %s execdomainsiomemswapsmountslockscmdlineioportsdmafilesystemsinterruptspartitionsdevicesstatksymsmodulescpuinfoversionmeminfouptimeloadavgkmsgkcoreprofileslabinfo/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hELFCOREvmlinux/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hpers_to_level()/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/raid/md_k.h%s/c%dd%d%s/c%dd%dp%dhd%s%c%d%s%c p%d %sStrange blocksize for partition table major minor #blocks name %4d %4d %10d %s <6>Partition check: <6> /dev/%s:<6> %s: unknown partition table /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h unable to read partition table [EZD] [DM6:DDO] [DM6:MBR] [DM6:AUX] [PTBL] < > /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hext2_get_group_descblock_group >= groups_count - block_group = %d, groups_count = %luGroup descriptor not loaded - block_group = %d, group_desc = %lu, desc = %luread_block_bitmapCannot read block bitmap - block_group = %d, block_bitmap = %luload_block_bitmap__load_block_bitmapblock_group != block_bitmap_numberext2_free_blocks: nonexistent deviceext2_free_blocksFreeing blocks not in datazone - block = %lu, count = %luFreeing blocks in system zones - Block = %lu, count = %lubit already cleared for block %luext2_new_block: nonexistent deviceext2_new_blockFree blocks count corrupted for block group %dAllocating block in system zone - block = %ubit already set for block %dblock(%d) >= blocks count(%d) - block_group = %d, es == %p /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.hrec_len is smaller than minimalrec_len % 4 != 0rec_len is too small for name_lendirectory entry across blocksinode out of boundsbad entry in directory #%lu: %s - offset=%lu, inode=%lu, rec_len=%d, name_len=%dext2_readdirdirectory #%lu contains a hole at offset %lu/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hread_inode_bitmapCannot read inode bitmap - block_group = %lu, inode_bitmap = %luload_inode_bitmapblock_group >= groups_count - block_group = %d, groups_count = %lublock_group != inode_bitmap_numberfree_inodereserved inode or nonexistent inodeext2_free_inodebit already cleared for inode %luext2_new_inodebit already set for inode %dFree inodes count corrupted in group %dreserved inode or inode > inodes count - block_group = %d,inode=%d/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hext2_block_to_pathblock < 0block > bigext2_free_branchesRead failure, inode=%ld, block=%ldext2_read_inodebad inode number: %lugroup >= groups countDescriptor not loadedunable to read inode block - inode=%lu, block=%luext2_write_inodeIO error syncing ext2 inode [%s:%08lx] /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hext2_find_entryext2_add_entryext2_delete_entry...empty_dirbad directory (dir #%lu) - no data blockbad directory (dir #%lu) - no `.' or `..'ext2_rmdirempty directory has nlink!=2 (%d)ext2_unlinkDeleting nonexistent file (%lu), %d/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hEXT2-fs panic (device %s): %s: %s <2>EXT2-fs error (device %s): %s: %s Remounting filesystem read-only <4>EXT2-fs warning (device %s): %s: %s ,bsddfnouid32checknoneEXT2 Check option not supported debugerrorsEXT2-fs: the errors option requires an argument continueremount-ropanicEXT2-fs: Invalid errors option: %s grpidbsdgroupsminixdfnochecknogrpidsysvgroupsresgidEXT2-fs: the resgid option requires an argument EXT2-fs: Invalid resgid option: %s resuidEXT2-fs: the resuid option requires an argumentEXT2-fs: Invalid resuid option: %s sbEXT2-fs: the sb option requires an argumentEXT2-fs: Invalid sb option: %s grpquotanoquotaquotausrquotaEXT2-fs: Unrecognized mount option %s EXT2-fs warning: revision level too high, forcing read/only mode EXT2-fs warning: mounting unchecked fs, running e2fsck is recommended EXT2-fs warning: mounting fs with errors, running e2fsck is recommended EXT2-fs warning: maximal mount count reached, running e2fsck is recommended EXT2-fs warning: checktime reached, running e2fsck is recommended [EXT II FS %s, %s, bs=%lu, fs=%lu, gc=%lu, bpg=%lu, ipg=%lu, mo=%04lx] 0.5b95/08/09ext2_check_descriptorsBlock bitmap for group %d not in group (block %lu)!Inode bitmap for group %d not in group (block %lu)!Inode table for group %d not in group (block %lu)!EXT2-fs: unable to read superblock VFS: Can't find an ext2 filesystem on dev %s. EXT2-fs: %s: couldn't mount because of unsupported optional features. EXT2-fs: %s: couldn't mount RDWR because of unsupported optional features. EXT2-fs: blocksize too small for device. EXT2-fs: Couldn't read superblock on 2nd try. EXT2-fs: Magic mismatch, very weird ! EXT2-fs: unsupported inode size: %d VFS: Unsupported blocksize on dev %s. EXT2-fs: fragsize %lu != blocksize %lu (not supported yet) EXT2-fs: #blocks per group too big: %lu EXT2-fs: #fragments per group too big: %lu EXT2-fs: #inodes per group too big: %lu EXT2-fs: not enough memory EXT2-fs: unable to read group descriptors EXT2-fs: group descriptors corrupted ! EXT2-fs: get root inode failed ext2/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hnfsNFS: delete_inode(%x/%ld) <3>nfs_delete_inode: inode %ld has pending RPC requests <5>nfs_get_root: getattr error = %d nfs warning: mount version %s than kernel oldernewer<5>NFS: NFSv3 not supported. <5>NFS: cannot retrieve file system info. <5>NFS: cannot initialize writeback cache. nfs_read_super: get root inode failed <4>NFS: couldn't start rpciod! <4>NFS: cannot create RPC client. <4>NFS: cannot create RPC transport. NFS: mount program didn't pass remote address! nfs_read_super: missing data argument nfs_statfs: statfs error = %d NFS: nfs_fhget(%s/%s fileid=%Ld) .snapshotNFS: nfs_fhget(snapshot ino=%ld) NFS: Buggy server - nlink == 0! __nfs_fhget: inode %ld still busy, i_count=%d NFS: __nfs_fhget(%x/%ld ct=%d) __nfs_fhget: iget failed nfs_notify_change: revalidate failed, error=%d nfs_notify_change: attr=%Ld, fattr=%Ld?? NFS: revalidating %s/%s, ino=%ld nfs_revalidate_inode: %s/%s getattr failed, ino=%ld, error=%d NFS: bad fh %08x%08x%08x%08x%08x%08x%08x%08x NFS: lookup failed, error=%d %08x%08x%08x%08x%08x%08x%08x%08x nfs_revalidate_inode: %s/%s refresh failed, ino=%ld, error=%d NFS: %s/%s revalidation complete <3>nfs_refresh_inode: inode or fattr is NULL <3>nfs_refresh_inode: empty inode NFS: refresh_inode(%x/%ld ct=%d info=0x%x) <3>nfs_refresh_inode: inode number mismatch expected (0x%Lx/0x%Lx), got (0x%Lx/0x%Lx) <7>nfs_refresh_inode: inode %ld mode changed, %07o to %07o /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hnfs: flush(%x/%ld) nfs: read(%s/%s, %lu@%lu) nfs: mmap(%s/%s) nfs: fsync(%x/%ld) nfs: write(%s/%s(%ld), %lu@%lu) <6>NFS: attempt to write to active swap file! NFS: nfs_lock(f=%4x/%ld, t=%x, fl=%x, r=%Ld:%Ld) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.h<3>NFS: Invalid unlock attempted NFS: nfs_readpage_sync(%p) NFS: nfs_proc_read(%s, (%s/%s), %Ld, %d, %p) NFS: %4d initiated read call (req %s/%s count %d nriov %d. <3>NFS: desynchronized value of nfs_i.nread. NFS: %4d nfs_readpage_result, (status %d) NFS: read (%s/%s %d@%Ld) NFS: nfs_readpage (%p %ld@%lu) Aiee.. nfs swap-in of page failed! nfs_read_data<6>nfs_read_data: not all structures were freed /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.h<3>NFS: Invalid unlock attempted NFS: nfs_writepage_sync(%s/%s %d@%Ld) NFS: short write, wsize=%u, result=%d <3>NFS: unlocked request attempted hashed! <3>NFS: unlocked request attempted unhashed! <3>NFS: desynchronized value of nfs_i.npages. <3>NFS: Add to list failed! <3>NFS: unlocked request attempted added to list! <3>NFS: unlocked request attempted removed from list! NFS: hit soft limit (%d requests) NFS: create_request sleeping (total %d pid %d) NFS: create_request waking up (tot %d pid %d) <3>NFS: Request released while still on a list! <3>NFS: Request released while still hashed! <3>NFS: Request released while still locked! write.c<3>NFS: desynchronized value of nfs_i.ndirty. NFS: nfs_updatepage(%s/%s %d@%Ld) NFS: nfs_updatepage returns %d (isize %Ld) NFS: %4d initiated write call (req %s/%s count %d nriov %d) NFS: %4d nfs_writeback_done (status %d) <4>NFS: Server wrote less than requested. NFS: write (%s/%s %d@%Ld), error = %d nfs_pagenfs_write_data<6>nfs_page: not all structures were freed <6>nfs_write_data: not all structures were freed /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hNFS: nfs_readdir_filler() reading cookie %Lu into page %lu. NFS: found cookie %Lu NFS: find_dirent() returns %d NFS: find_dirent_page() searching directory page %ld NFS: find_dirent_page() returns %d NFS: readdir_search_pagecache() searching for cookie %Lu NFS: readdir_search_pagecache() returned %d NFS: nfs_do_filldir() filling starting @ cookie %Lu NFS: nfs_do_filldir() filling ended @ cookie %Lu; returning = %d NFS: uncached_readdir() searching for cookie %Lu NFS: uncached_readdir() returns %d nfs_lookup_validate: %s/%s has dud inode NFS: dentry_delete(%s/%s, %x) NFS: lookup(%s/%s) NFS: create(%x/%ld, %s NFS: mknod(%x/%ld, %s NFS: mkdir(%x/%ld, %s NFS: rmdir(%x/%ld, %s NFS: silly-rename(%s/%s, ct=%d) NFS: silly-renaming %s/%s, negative dentry?? .nfs%*.*lx%*.*xtrying to rename %s to %s NFS: safe_remove(%s/%s) nfs_safe_remove: %s/%s busy, d_count=%d NFS: unlink(%x/%ld, %s) NFS: symlink(%x/%ld, %s, %s) nfs_proc_symlink: %s/%s not negative! nfs_proc_symlink: %s/%s already exists?? NFS: link(%s/%s -> %s/%s) NFS: rename(%s/%s -> %s/%s, ct=%d) nfs_rename: target %s/%s busy, d_count=%d nfs_fh<6>nfs_fh: not all structures were freed /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hNFS call getroot NFS reply getroot NFS call getattr NFS reply getattr NFS call setattr NFS reply setattr NFS call lookup %s NFS reply lookup: %d NFS call readlink NFS reply readlink: %d NFS call read %d @ %Ld NFS reply read: %d NFS call write %d @ %Ld NFS reply write: %d NFS call create %s NFS reply create: %d NFS call mknod %s NFS reply mknod: %d NFS call remove %s NFS reply remove: %d NFS call rename %s -> %s NFS reply rename: %d NFS call link %s NFS reply link: %d NFS call symlink %s -> %s NFS reply symlink: %d NFS call mkdir %s NFS reply mkdir: %d NFS call rmdir %s NFS reply rmdir: %d NFS call readdir %d NFS reply readdir: %d NFS call statfs NFS reply statfs: %d /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.h<3>NFS: Bad number of iov's in xdr_readargs <4>NFS: Odd RPC header size in read reply: %d <4>NFS: server cheating in read reply: count %d > recvd %d RPC: readres OK count %d <3>NFS: Bad number of iov's in xdr_writeargs (nr %d max %d) <4>NFS: Odd RPC header size in readdirres reply <3>NFS: Bad result buffer in readdir <4>NFS: giant filename in readdir (len 0x%x)! <5>NFS: short packet in readdir reply! <3>nfs_stat_to_errno: bad nfs status return value: %d nfs_statfsnfs_readdirnfs_rmdirnfs_mkdirnfs_symlinknfs_linknfs_renamenfs_removenfs_createnfs_writenfs_writecachenfs_readnfs_readlinknfs_lookupnfs_rootnfs_setattrnfs_getattrnfs_null/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hnfs_flushdNFS: writecache_init NFS: reqlist_exit (ptr %p rpc %p) NFS: %4d flushd starting NFS: %4d flushd back to sleep /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hnfs_delete_queue/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hacdirmaxacdirminacregmaxacregminretranstimeowsizersizeportbroken_suidtcpudpnolocklocknoacacnoctoctonoposixposixnointrintrhardsoft,default/tftpboot/%s<3>Root-NFS: Pathname for remote directory too long. <3>Root-NFS: No NFS server available, giving up. <5>Looking up port of RPC %d/%d on %s <3>Root-NFS: Unable to get nfsd port number from server, using default Root-NFS: Portmapper on server returned %d as nfsd port <3>Root-NFS: Unable to get mountd port number from server, using default Root-NFS: mountd port is %d <3>Root-NFS: Server returned error %d while mounting %s unknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.hNFS: nfs_mount(%08x:%s) mnt_mountmnt_nullmnt3_mountmnt3_nullmount/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.h%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: CANCEL call failed (errno %d) <4>lockd: Uh-oh! Interfering reclaims for host %s/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/nfs_fs.h%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! %d@%s<5>NFSv4 file locking not implemented! lockd: clnt proc returns %d nlmclnt_alloc_call: failed, waiting for memory lockd: call procedure %s on %s lockd: rpc_call returned error %d lockd: server in grace period <4>lockd: spurious grace period reject?! lockd: server returns status %d lockd: call procedure %s on %s (async) <5>lockd: failed to monitor %s <4>lockd: failed to reclaim lock for pid %d (errno %d, status %d) lockd: unexpected unlock status: %d lockd: unlock failed (err = %d) lockd: CANCEL call error %d, retrying. lockd: cancel status %d (task %d) lockd: CANCEL failed (server has no locks) <5>lockd: weird return %d for CANCEL call <5>lockd: unexpected status NLM_BLOCKED <5>lockd: unexpected server status %d /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: no clnt or addr in lookup_host! lockd: nlm_lookup_host(%08x, p=%d, v=%d) lockd: creating host entry %d.%d.%d.%dlockd: nlm_bind_host(%08x) lockd: next rebind in %ld jiffies lockd: couldn't create RPC handle for %s lockd: rebind host %s lockd: get host %s lockd: release host %s lockd: shutting down host module lockd: nuking all hosts... <4>lockd: couldn't shutdown host module! lockd: %d hosts left: %s (cnt %d use %d exp %ld) lockd: host garbage collection lockd: delete host %s <4>lockd: active RPC handle /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockdNFS locking service started (ver 0.4). <4>lockd: terminating on error %d lockd: request from %08x <7>lockd: new process, skipping host shutdown <4>lockd_up: no pid, %d users?? <4>lockd_up: create service failed <4>lockd_up: makesock failed, error=%d <4>lockd_up: create thread failed, error=%d <4>lockd_down: no users! pid=%d <4>lockd_down: no lockd running. <4>lockd_down: lockd failed to exit, clearing pid /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlmsvc_insert_block(%p, %ld) lockd: nlmsvc_lookup_block f=%p pd=%d %Ld-%Ld ty=%d lockd: check f=%p pd=%d %Ld-%Ld ty=%d cookie=%x cookie: head of blocked queue %p, block %p lockd: created block %p... lockd: deleting block %p... lockd: deleting granted lock lockd: unblocking blocked lock lockd: nlmsvc_lock(%04x/%ld, ty=%d, pi=%d, %Ld-%Ld, bl=%d) lockd: posix_lock_file returned %d lockd: blocking on this lock (allocating). lockd: blocking on this lock. lockd: nlmsvc_testlock(%04x/%ld, ty=%d, %Ld-%Ld) lockd: conflicting lock(ty=%d, %Ld-%Ld) somehostlockd: nlmsvc_unlock(%04x/%ld, pi=%d, %Ld-%Ld) lockd: nlmsvc_cancel(%04x/%ld, pi=%d, %Ld-%Ld) lockd: VFS unblock notification for block %p <4>lockd: notification for unknown block! lockd: grant blocked lock %p lockd: lock still blocked <4>lockd: unexpected error %d in %s! nlmsvc_grant_blockedlockd: GRANTing blocked lock. lockd: GRANT_MSG RPC callback callback: looking for cookie %x lockd: no block for cookie %x nlmsvc_retry_blocked(%p, when=%ld) nlmsvc_retry_blocked(%p, when=%ld, done=%d) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: unauthenticated request from (%08x:%d) lockd: NULL called lockd: TEST called lockd: TEST status %d vers %d lockd: LOCK called lockd: LOCK status %d lockd: CANCEL called lockd: CANCEL status %d lockd: UNLOCK called lockd: UNLOCK status %d lockd: GRANTED called lockd: GRANTED status %d lockd: TEST_MSG called lockd: LOCK_MSG called lockd: CANCEL_MSG called lockd: UNLOCK_MSG called lockd: GRANTED_MSG called lockd: SHARE called lockd: SHARE status %d lockd: UNSHARE called lockd: UNSHARE status %d lockd: NM_LOCK called lockd: SM_NOTIFY called <4>lockd: rejected NSM callback from %08x:%d lockd: %4d callback failed (errno = %d) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! lockd: nlm_file_lookup(%08x %08x %08x %08x %08x %08x) lockd: creating file for (%08x %08x %08x %08x %08x %08x) lockd: open failed (nfserr %d) lockd: found file %p (count %d) lockd: closing file %s/%ld <4>lockd: attempt to release unknown file! lockd: unlock failure in %s:%d svcsubs.clockd: nlm_release_file(%p, ct = %d) lockd: nlmsvc_mark_resources lockd: nlmsvc_free_host_resources <4>lockd: couldn't remove all locks held by %slockd: invalidating client for %s unknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <7>nsm_mon_unmon: rpc failed, status=%d lockd: nsm_monitor(%s) <5>lockd: cannot monitor %s lockd: nsm_unmonitor(%s) <5>lockd: cannot unmonitor %s localhostnsm: xdr_encode_mon(%08x, %d, %d, %d) %d.%d.%d.%dnsm: xdr_decode_stat_res status %d state %d sm_notifysm_simu_crashsm_unmon_allsm_unmonsm_monsm_statsm_nullstatd/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%d: %08x %08x %08x %08x %08x %08x<3>fh_copy: copying %s/%s, already verified! nfsd: fh_lock(%s) locked = %d <3>fh_lock: fh not verified! <4>fh_lock: %s/%s already locked! <3>fh_unlock: fh not verified! <5>lockd: bad cookie size %d (only cookies under 8 bytes are supported.) <5>lockd: bad fhandle size %x (should be %d) nlm_undefnlm_granted_resnlm_unlock_resnlm_canc_resnlm_lock_resnlm_test_resnlm_granted_msgnlm_unlock_msgnlm_canc_msgnlm_lock_msgnlm_test_msgnlm_grantednlm_unlocknlm_cancnlm_locknlm_testnlm_nulllockd/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h...%d/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hdevpts_put_super: badness: entry %d count %d ,uidgidmodedevpts: called with bogus options devpts: get root dentry failed devpts/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>ipc_init_ids() failed, ipc service disabled. util.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsysvipc/msgmsg.c key msqid perms cbytes qnum lspid lrpid uid gid cuid cgid stime rtime ctime %10d %10d %4o %10lu %10lu %5u %5u %5u %5u %5u %5u %10lu %10lu %10lu /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsysvipc/semsem.cfreeundos undo list error id=%d sem_exit undo list error id=%d key semid perms nsems uid gid cuid cgid otime ctime %10d %10d %4o %10lu %5u %5u %5u %5u %10lu %10lu /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hshmsysvipc/shm,nr_blocksnr_inodesmode<3>shm fs invalid option <3>shm_read_super: get root inode failed <7>shm_nattch = %ld ....IPC_%08xshm.c<3>Unlink of SHM id %d failed (%d). key shmid perms size cpid lpid nattch uid gid cuid cgid atime dtime ctime name %10d %10d %4o %10u %5u %5u %5d %5u %5u %5u %5u %10lu %10lu %10lu %.*s%s %10d %10d %4o %21u %5u %5u %5d %5u %5u %5u %5u %10lu %10lu %10lu %.*s%s (deleted)dev/zero3/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hpers_to_level()/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/raid/md_k.hblk_cleanup_queue: leaked requests (%d) @BV(V(X(<3>drive_stat_acct: cmd not R/W? ll_rw_blk.celevator returned crap (%d) <6>attempt to access beyond end of device <6>%s: rw=%d, want=%d, limit=%d <3>generic_make_request: Trying to access nonexistent block-device %s (%ld) <5>ll_rw_block: device %s: only %d-char blocks implemented (%u) <5>Can't write to read-only device %s end_request: I/O error, dev %s (%s), sector %lu end_request: buffer-list destroyed end_that_request_last called with non-dequeued req blkdev_requestsCan't create request pool slab cache /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hNULL ttyWarning: bad magic number for tty struct (%s) in %s Warning: null TTY for (%s) in %s Warning: dev (%s) tty->count(%d) != #fd's(%d) in %s tty-ldisc-%dCouldn't open N_TTY ldisc for %s --- error %d.tty_check_change: tty->pgrp <= 0! do_tty_hangupdo_tty_hangup: N_TTY open: error %d tty_readtty_writeinit_dev: ldisc open failed, clearing slot %d release_devrelease_dev: bad idx when trying to free (%s) release_dev: driver.table[%d] not tty for (%s) release_dev: driver.termios[%d] not termios for (%s) release_dev: driver.termios_locked[%d] not termios_locked for (%s) release_dev: other->table[%d] not o_tty for (%s) release_dev: other->termios[%d] not o_termios for (%s) release_dev: other->termios_locked[%d] not o_termios_locked for (%s) release_dev: bad pty pointers release_dev: %s: read/write wait queue active! release_dev: bad pty slave count (%d) for %s release_dev: bad tty->count (%d) for %s tty_open<4>tty_io.c: process %d (%s) used obsolete /dev/%s - update software to use /dev/ttyS%d tty_polltty_fasynctty_ioctlUse of setserial/setrocket to set SPD_* flags is deprecated size of tty structure > PAGE_SIZE!/dev/ttyCouldn't register /dev/tty driver /dev/consoleCouldn't register /dev/console driver /dev/ptmxCouldn't register /dev/ptmx driver /dev/vc/0Couldn't register /dev/tty0 driver /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hmaster pty_close: count = %d!! pty_ioctl called with NULL tty! pty_unix98_ioctl called with NULL tty! pty_masterptypty_slavettypCouldn't register pty driverCouldn't register pty slave driverptspty: %d Unix98 ptys configured ptmCouldn't register Unix98 ptm driver major %dCouldn't register Unix98 pts driver major %d/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hhead%3i %s char-major-%d-%dmiscunable to get major %d for misc devices /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h n;AvXaM ְdx <5>get_random_bytes called before random driver initialization %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xuuidboot_idwrite_wakeup_thresholdread_wakeup_thresholdentropy_availpoolsize/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h[%d;%dR[?6c%c%c%ccon_write: tty %d not allocated vc/%dCouldn't register console driver Console: %s %s %dx%dcolourmono Console: switching consoles %d-%d to %s %s %dx%d to %s unblank_screen: tty %d not allocated ?? /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<4>selection: kmalloc() failed /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>keyboard.c: do_lowercase was called - impossible <3>do_fn called with value=%d 0123456789+-*/ ,.?()#pqrstuvwxylSRQMnnmPQSBDCA/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<6>SysRq: Keyboard mode set to XLATE SAK Resetting Power off Emergency Sync Emergency Remount R/O Show Regs Show State Show Memory Log level set to %d Terminate All Tasks Kill All Tasks Kill ALL Tasks (even init) unRaw saK Boot Off Sync Unmount showPc showTasks showMem loglevel0-8 tErm kIll killalL <6>%sing device %s ... RemountSyncR/O error %d OK nothing to do <6>Done. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h %s: %d input overrun(s) %s: unknown flag %d n_tty_read_chan: called with read_buf == NULL?!? read_chan: tty->pgrp <= 0! n_tty/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hWarning?!? termios_locked is NULL. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h@35@35@3@5@35@35@35@35 @35urandomrandomfullzeroportnullkmemmemunable to get major %d for memory devs /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hraw/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hvcsunable to get major %d for vcs devicevcc0a/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hSA1100 serial driver1.3rs_stoprs_startout-status0 = %x, status1 = %x...rs_single loop break. serialrs_put_charrs_flush_charsrs_writers_write_roomrs_chars_in_bufferrs_flush_bufferrs_send_charrs_throttlers_unthrottlers_breakrs_ioctlTIOCSER?WILD ioctl obsolete, ignored. rs_closers_close: bad serial port count; tty->count is 1, state->count is %d rs_close: bad serial port count for ttys%d: %d rs_wait_until_sentrs_hanguprs_open@@@ttyS%d on SA1100 UART3 (irq %d) ttyS%d on SA1100 UART1 (irq %d), using GPIO 14/15 ttyS%d on SA1100 UART2 (irq %d), using IRDA ttyS%d: unsupported device %s version %s SA1100 serialttyScuaCouldn't register serial driver Couldn't register callout driver SERIAL: failed to unregister serial driver (%d) SERIAL: failed to unregister callout driver (%d) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<4>Keyboard timed out[1] <4>Mouse timed out[1] <6>keyboard: unknown e1 escape sequence <6>keyboard: unknown scancode e0 %02x <6>keyboard: unrecognized scancode (%02x) - ignored <3>pc_keyb: keyboard controller jammed (0x%02X). <3>pc_keyb: mouse controller jammed (0x%02X). <4>keyboard: Timeout - AT keyboard not present? <4>keyboard: Too many NACKs -- noisy kbd cable? Keyboard reset failed, no ACKKeyboard reset failed, no PORDisable keyboard: no ACKEnable keyboard: no ACKSet rate: no ACK<4>initialize_kbd: %s keyboard8390.c:v1.10cvs 9/23/94 Donald Becker (becker@cesdis.gsfc.nasa.gov) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<0>%s: ei_open passed a non-existent device! <4>%s: xmit on stopped card <7>%s: Tx timed out, %s TSR=%#2x, ISR=%#2x, t=%d. lost interrupt?cable problem?excess collisions.<7>%s: idle transmitter tx2=%d, lasttx=%d, txing=%d. <7>%s: idle transmitter, tx1=%d, lasttx=%d, txing=%d. <7>%s: No Tx buffers free! tx1=%d tx2=%d last=%d net_interrupt(): irq %d for unknown device. %s: Interrupted while interrupts are masked! isr=%#2x imr=%#2x. %s: Reentering the interrupt handler! isr=%#2x imr=%#2x. <7>%s: interrupt(isr=%#2.2x). <4>%s: interrupt from stopped card <4>%s: Too much work at interrupt, status %#2.2x <4>%s: unknown interrupt %#2x <3>%s: bogus last_tx_buffer %d, tx1=%d. %s: bogus last_tx_buffer %d, tx2=%d. <3>%s: mismatched read page pointers %2x vs %2x. <7>%s: bogus packet size: %d, status=%#2x nxpg=%#2x. <7>%s: Couldn't allocate a sk_buff of size %d. <7>%s: bogus packet: status=%#2x nxpg=%#2x size=%d %s: next frame inconsistency, %#2x <7>%s: Receiver overrun. <6>%s: invalid multicast address length given. 8390.c: header struct mispacked <3>Hw. address read/write mismap %d <4>%s: trigger_send() called with the transmitter busy. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>alloc_dev: Unable to allocate device memory. eth%d/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsmc9194.c:v0.13 04/14/00 by Erik Stahlman (erik@vt.edu) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hSMC91C110SMC91C100FDSMC91C100SMC91C96SMC91C95SMC91C94SMC91C90/91C92AUITPSMC9194: Bad Craziness - sent packet while busy. SMC9194: Far too big packet error. SMC9194: In XMIT with no packet to send <7>SMC9194: Memory allocation failed. SMC9194: 1st bank read failed (%x) SMC9194: 2st bank read failed (%x) SMC9194: IO %x: Unrecognized revision register: %x, Contact author. %sSMC9194: uninitialized MAC address detected -- using a dummy one SMC9194: Couldn't autodetect your IRQ. Use irq=xx. SMC9194: %s(r:%d) at %#3x IRQ:%d INTF:%s MEM:%db ADDR: %2.2x:%2.2x SMC9194SMC9194: unable to get IRQ %d (irqval=%d). <4>SMC9194: transmit timed out, %s? IRQ conflictSMC9194: UNSUPPORTED: EPH INTERRUPT SMC9194: UNSUPPORTED: ERCV INTERRUPT SMC9194: WARNING: smc_rcv with nothing on FIFO. <5>SMC9194: Low memory, packet dropped. <7>SMC9194: Late collision occurred on last xmit. SMC9194: Successful packet caused interrupt /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hUDMA 7UDMA 6UDMA 5UDMA 4UDMA 3UDMA 2UDMA 1UDMA 0MW DMA 2MW DMA 1MW DMA 0SW DMA 2SW DMA 1SW DMA 0PIO 4PIO 3PIO 2PIO 1PIO 0PIO SLOWXFER ERRORscsi disk opticalcdrom tape floppy ???????ide_dma_readide_dma_writeide_dma_beginide_dma_end:ide_dma_checkide_dma_onide_dma_offide_dma_off_quietlyide_dma_test_irqide_dma_bad_driveide_dma_good_driveide_dma_verboseide_dma_retuneide_dma_lostirqide_dma_timeoutunknown%s: CHECK for good STATUS %s: Speed warnings UDMA 3/4/5 is not functional. set_drive_speed_status/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h!"89XYZ[KODAK ATA_FLASHHitachi CVSunDisk SDCFBHAGIWARA HPCLEXAR ATA_FLASHATA_FLASHide: Assuming %dMHz system bus speed for PIO modes%s ; override with idebus=xx%s: ide_set_handler: handler not null; old=%p, new=%p %s: ATAPI reset complete %s: ATAPI reset timed-out, status=0x%02x %s: reset timed-out, status=0x%02x %s: reset: success master: passedformatter device errorsector buffer errorECC circuitry errorcontrolling MPU errorerror (0x%02x?); slave: failed %s: %s: status=0x%02x { Busy DriveReady DeviceFault SeekComplete DataRequest CorrectedError Index Error }%s: %s: error=0x%02xDriveStatusError %sBadCRC BadSector UncorrectableError SectorIdNotFound TrackZeroNotFound AddrMarkNotFound , LBAsect=%ld, CHS=%d/%d/%d, sector=%lddrive_cmd%s: bad special flag: 0x%02x status timeoutstatus error%s: bad device number: %s %s%c: bad access: block=%ld, count=%ld %s: drive not ready for command %s: media type %d not supported ide_set_handler: timer already active %s: Huh? nuking plugged queue ide_timer_expiry: hwgroup->drive was NULL %s: ide_timer_expiry: hwgroup->busy was 0 ?? %s: lost interrupt %s: timeout waiting for DMA irq timeout%s%s: unexpected interrupt, status=0x%02x, count=%ld (?)%s: ide_intr: hwgroup->busy was 0 ?? %s: ide_intr: huh? expected NULL handler on exit %s: driver not present capacitygd not in disk chain! %s: channel busy io_32bitkeepsettingsnice1pio_modeslowunmaskirqusing_dmaide_scsiinit_speedcurrent_speednumber01234567890123456789abcdefhdideidebuside_setup: %snonenoprobenowerrcdromserializeautotunenoautotuneswapdatabswapflashremapnoremapscsiq3$q3,q34q3Uniform Multi-Platform E-IDE driver Revision: 6.31 /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h!"89<5>ide_cs: ide_register() at 0x%3x & 0x%3x, irq %u failed hd%c<6>ide_cs: %s: Vcc = %d.%d, Vpp = %d.%d <5>ide_cs: Card Services release does not match! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hread_intr%s: write_intr error1: nr_sectors=%ld, stat=0x%02x write_intr%s: buffer list corrupted (%ld, %ld, %d) multwrite_intrset_multmodeset_geometry_intrrecal_intr<3>%s: no DRQ after issuing %s MULTWRITEWRITE<3>%s: bad command: %d <3>%s: bad special flag: 0x%02x %i (none) %04x%csmart_thresholdssmart_valuesgeometrycachebios_cylbios_headbios_sectbswapmultcountnowerrbreada_readaheadfile_readaheadmax_kb_per_requestlunide-disk1.10<6>%s: %ld sectors (%ld MB) w/%dKiB Cache, CHS=%d/%d/%d <3>ide-disk: %s: Failed to register the driver with ide.c <3>%s: INVALID GEOMETRY: %d PHYSICAL HEADS? /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h @ [remap +63] [remap 0->1]%s%s [%d/%d/%d]/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.h%s: drive->id->word156 == 0x%04x E X A B Y T E N E S T%s: %s, ATAPI CD-ROMoppypoypZIPcdrom or floppy?, assuming FLOPPYCDROMTAPEOPTICALUNKNOWN (type %d) drive ATA DISK drive %s: probing with STATUS(0x%02x) instead of ALTSTATUS(0x%02x) %s: IRQ probe failed (0x%lx) %s: no response (status = 0x%02x), resetting drive %s: no response (status = 0x%02x) %s: enabling %s -- failed (timeout) failed (status = 0x%02x) success %s: non-IDE drive, CHS=%d/%d/%d %s: ATAPI cdrom (?) %s: ERROR, PORTS ALREADY IN USE %s: ports already in use, skipping probe %s: reset %s: potential irq problem with %s and %s %s at 0x%03x-0x%03x,0x%03x on irq %d (%sed with %s)sharserializ hdhost%d/bus%d/target%d/lun%d%s: DISABLED, NO IRQ %s: UNABLE TO GET MAJOR NUMBER %d %s: Disabled unable to get IRQ %d. %s: probed IRQ %d and default IRQ %d failed. %s: probed IRQ %d failed, using default. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/highmem.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/pagemap.hproc_ide: error: %s: '%s' /proc/ide/%s/config: channel(s) busy, cannot write not a PCI deviceexpected 'R' or 'P'bad/missing register numbermissing ':'bad data, 2/4/8 digits requiredexpected whitespace after dataparse error (none) %s version %s (none)genericpcicmd640dtc2278ali14xxqd6580umc8672ht6560bpdc4030rz1000trm290cmd646cy82c6934drivesmac-ioacorn(unknown)%s %04x%c name value min max mode ---- ----- --- --- ---- %-24s%-16d%-16swrite-only%-16d%-16drwproc_ide_write_settings(): parse error %li physical %d/%d/%d logical %d/%d/%d %.40s disk cdrom tape floppy UNKNOWN settingsmodelmediaidentifydriveride%d/%smateconfigchannelidedriverside/drivers/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<5>ds: unable to create instance of '%s'! %-24.24s %d %d <5>ds: unable to bind MTD '%s' to socket %d offset 0x%x <5>ds: unable to bind '%s' to socket %d <5>ds: Card Services release does not match! <5>ds: no socket drivers loaded! pcmcia<5>unable to find a free device # for Driver Services drivers/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hLinux PCMCIA Card Services 3.1.22options: none333Ԏ3̎3Ď333 3 3 3 t3l3d3X3H383$33333ԍ33333x3 h3!\3@L3Bad CIS tupleBad handleOut of resourceNo more itemsResource in useConfiguration lockedBad argumentsBad argument lengthWrite protectedGeneral failureResource busyBad speedUnsupported modeUsupported functionNo card presentWrite failureBad windowBad VppBad VccBad typeBad socketBad sizeRead failureBad page numberBad offsetBad IRQBad EDCBad base addressBad attributeBad adapterOperation succeeded3l3X3H3<3(333 3 Ԓ3 Ē3 3333t3d3X3H3<3(33 333 3!Б3"đ3$3&3'3)3+l3-`3.T3/@30031$33353738393:ܐ3;А3<Đ3=3>3?3ReplaceCISInsertCardEjectCardResumeCardSuspendCardReportErrorBindMTDBindDeviceWriteMemoryValidateCISSetEventMaskResetCardRequestWindowRequestSocketMaskRequestIRQRequestIORequestConfigurationReleaseWindowReleaseIRQReleaseIOReleaseConfigurationRegisterMTDRegisterEraseQueueRegisterClientReadMemoryParseTupleOpenMemoryModifyWindowModifyConfigurationMapMemPageGetTupleDataGetStatusGetNextTupleGetNextRegionGetNextClientGetFirstTupleGetFirstRegionGetFirstClientGetEventMaskGetConfigurationInfoGetClientInfoGetCardServicesInfoDeregisterEraseQueueDeregisterClientCloseMemoryCheckEraseQueueAdjustResourceInfoAddSocketServicesAccessConfigurationRegister%02d<5>cs: socket %p voltage interrogation timed out <5>cs: socket %p: unsupported voltage key <5>cs: unsupported card type detected! <5>cs: socket %p timed out during reset. Try increasing setup_delay. <5><5>%s: Unknown service number%s: %s %s: Unknown error code %#x <6>%s <6> %s pccard<6>unloading PCMCIA Card Services /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h #(-27cs: unable to map card memory! CIS/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<6>cs: memory probe 0x%06lx-0x%06lx: excluding %#05lx-%#05lx clean. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<5>cs: do_mtd_request interrupted! <5>cs: MTD request timed out! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<6>SA-1100 PCMCIA (CS release %s) 3.1.22<3>Card Services release codes do not match <3>This hardware is not supported by the SA1100 Card Service driver <3>Unable to initialize kernel PCMCIA service. <3>Unable to get PCMCIA status from kernel. <3>sa1100: invalid CCF code (0x%02x) <3>Unable to register socket service routine <3>Error in kernel low-level PCMCIA service. <3>sa1100: socket %u not configured <3>Error obtaining IRQ info from kernel for socket %u <3>Unable to configure socket %u <3>%s(): map (%d) out of range sa1100_pcmcia_get_io_mapsa1100_pcmcia_set_io_mapsa1100_pcmcia_get_mem_mapsa1100_pcmcia_set_mem_mapstatus<3>Unable to install "status" procfs entry k_flags : %s%s%s%s%s%s%s detect ready bvd1 bvd2 wrprot vs_3v vs_Xv status : %s%s%s%s%s%s%s%s%s SS_DETECT SS_READY SS_POWERON SS_IOCARD SS_STSCHG SS_BATDEAD SS_BATWARN SS_3VCARD SS_XVCARD mask : %s%s%s%s%s cs_flags : %s%s%s%s%s SS_PWR_AUTO SS_RESET SS_SPKR_ENA SS_OUTPUT_ENA Vcc : %d Vpp : %d irq : %d I/O : %u attribute: %u common : %u /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hCF_CDCF_BVD2CF_BVD1<3>%s: Request for IRQ %lu failed assabet_pcmcia_init<4>%s(): CS asked for 5V, applying 3.3V... assabet_pcmcia_configure_socket<3>%s(): unrecognized Vcc %u /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hNeponset PCMCIA (0) CDNeponset CF (1) CDNeponset PCMCIA (0) BVD1Neponset CF (1) BVD1<3>%s(): unrecognized Vcc %u neponset_pcmcia_configure_socket<3>%s(): unrecognized Vpp %u <3>%s(): CF slot cannot support Vpp %u /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h10base210baseTauto!H    <6>pcnet_cs: sorry, the AX88190 chipset is not supported. <5>pcnet_cs: invalid if_port requested <5>pcnet_cs: register_netdev() failed <5>pcnet_cs: unable to read hardware net address for io base %#3lx NE2000<6>%s: NE2000 (DL100%d rev %02x): <6>%s: NE2000 (AX88190): <6>%s: NE2000 Compatible: io %#3lx, irq %d, mem %#5lx, %s xcvr, hw_addr %02X%s: <3>%s: unable to request IRQ <3>%s: pcnet_reset_8390() did not complete. <6>%s: switched to %s port <6>%s: interrupt(s) dropped! <6>%s: %s link beat foundlost<6>%s: autonegotiation complete: %sbaseT-%cD selected 10010<6>%s: link partner did not autonegotiate <5>%s: DMAing conflict in dma_block_input.[DMAstat:%1x][irqlock:%1x] <5>%s: DMAing conflict in dma_block_output.[DMAstat:%1x][irqlock:%1x] <5>%s: timeout waiting for Tx RDC. <5>pcnet_cs: Card Services release does not match! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>usb.c: error registering %s driver <6>usb.c: registered new driver %s <3>usb.c: null device being purged!!! <6>usb.c: deregistering driver %s <4>usb.c: too many buses <6>usb.c: new USB bus registered, assigned bus number %d <6>usb.c: USB bus %d deregistered <3>usb.c: null device being checked!!! <3>usb.c: bad find_interface_driver params <4>usb.c: USB device %d (vend/prod 0x%x/0x%x) is not claimed by any active driver. <3>usb.c: alloc_urb: kmalloc failed usb_control/bulk_msg: timeout <3>usb.c: ran out of descriptors parsing <4>usb.c: unexpected descriptor 0x%X, expecting endpoint descriptor, type 0x%X <3>usb.c: invalid descriptor length of %d <3>usb.c: couldn't allocate memory for endpoint extra descriptors <3>usb.c: couldn't kmalloc interface->altsetting <4>usb.c: too many alternate settings (max %d) <3>usb.c: couldn't allocate memory for interface extra descriptors <4>usb.c: too many endpoints <3>usb.c: out of memory <4>usb.c: too many interfaces <3>usb.c: couldn't allocate memory for config extra descriptors %xUSB %s Root Hub<6>usb.c: USB disconnect on device %d remove<4>usb.c: selecting invalid interface %d <4>usb.c: selecting invalid configuration %d <4>usb.c: too many configurations <4>usb.c: not enough configurations <3>usb.c: unable to get descriptor <3>usb.c: config descriptor too short (expected %i, got %i) <3>usb.c: unable to allocate memory for configuration descriptors <3>usb.c: couldn't get all of config descriptors <3>usb.c: error getting string descriptor 0 (error=%d) <3>usb.c: string descriptor 0 too short <3>usb.c: USB device not accepting new address=%d (error=%d) <3>usb.c: USB device not responding, giving up (error=%d) <3>usb.c: USB device descriptor short read (expected %i, got %i) <3>usb.c: unable to get device descriptor (error=%d) <3>usb.c: unable to get device %d configuration (error=%d) <3>usb.c: failed to set device %d default configuration (error=%d) addusb<3>usb.c: unable to get major %d for usb devices /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h Interface: %d Invalid USB device descriptor (NULL POINTER) Length = %2d%s (!!!) DescriptorType = %02x USB version = %x.%02x Vendor:Product = %04x:%04x MaxPacketSize0 = %d NumConfigurations = %d Device version = %x.%02x Device Class:SubClass:Protocol = %02x:%02x:%02x Per-interface classes Audio device class Communications class Human Interface Devices class Printer device class Mass Storage device class Hub device class Vendor class Unknown class Configuration: bLength = %4d%s bDescriptorType = %02x wTotalLength = %04x bNumInterfaces = %02x bConfigurationValue = %02x iConfiguration = %02x bmAttributes = %02x MaxPower = %4dmA Alternate Setting: %2d bLength = %4d%s bDescriptorType = %02x bInterfaceNumber = %02x bAlternateSetting = %02x bNumEndpoints = %02x bInterface Class:SubClass:Protocol = %02x:%02x:%02x iInterface = %02x (Audio)ControlIsochronousBulkInterrupt3333 Endpoint: bLength = %4d%s bDescriptorType = %02x bEndpointAddress = %02x (%s) inouti/o bmAttributes = %02x (%s) wMaxPacketSize = %04x bInterval = %02x bRefresh = %02x bSynchAddress = %02x <6>%s: %s urb :%p next :%p dev :%p pipe :%08X status :%d transfer_flags :%08X transfer_buffer :%p transfer_buffer_length:%d actual_length :%d setup_packet :%p start_frame :%d number_of_packets :%d interval :%d error_count :%d context :%p complete :%p /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<3>hub.c: Unable to kmalloc %d bytes for hub descriptor <3>hub.c: Unable to get hub descriptor (err = %d) <6>hub.c: %d port%s detected s<3>hub.c: Unable to get hub status (err = %d) <3>hub.c: couldn't allocate interrupt urb <3>hub.c: usb_submit_urb failed (%d) <3>hub.c: invalid subclass (%d) for USB hub device #%d <3>hub.c: invalid bNumEndpoints (%d) for USB hub device #%d <3>hub.c: Device #%d is hub class, but has output endpoint? <3>hub.c: Device #%d is hub class, but has endpoint other than interrupt? <6>hub.c: USB hub found <3>hub.c: couldn't kmalloc hub struct <3>hub.c: hub configuration failed for device #%d <3>hub.c: cannot disconnect hub %d <3>hub.c: get_port_status(%d) failed (err = %d) <3>hub.c: Cannot enable port %i of hub %d, disabling port. <3>hub.c: Maybe the USB cable is bad? <3>hub.c: cannot disable port %d of hub %d (err = %d) <3>hub.c: couldn't allocate usb_device %d%d/%s<6>hub.c: USB new device connect on bus%d/%s, assigned device number %d <6>hub.c: USB new device connect on bus%d, assigned device number %d <3>hub.c: error resetting hub %d - disconnecting <3>hub.c: get_port_status failed (err = %d) <3>hub.c: already running port %i disabled by hub (EMI?), re-enabling... <3>hub.c: port %d over-current change <3>hub.c: get_hub_status failed khubdhub<3>hub.c: Unable to register USB hub driver <3>hub.c: failed to start usb_hub_thread <3>hub.c: giving up on killing khubd <3>hub.c: attempting to reset root hub! <3>hub.c: USB device not accepting new address (error=%d) <3>hub.c: unable to get device descriptor (error=%d) <3>hub.c: USB device descriptor short read (expected %i, got %i) <3>hub.c: unable to get configuration (error=%d) <3>hub.c: failed to set active configuration (error=%d) <3>hub.c: failed to set active alternate setting for interface %d (error=%d) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsa1111_hc_dma_setup: consistent_alloc returns vaddr: paddr: usb-ohcibuiltinsa1111_alloc_consistent(size=%d) memp=%p,memp_left=%d usb-ohci: can't alloc more memoryusb-ohci-sa1111.h: allocated pages; mem %p (%p) sa1111_alloc_consistent() mem %p, dma %p ohci_virt_to_bus(v=%p) -> %p ohci_bus_to_virt(p=%p) -> %p __alloc(%d) gets %p allocated %d alloc buffers of %d bytes @ %p ALLOCATED UNALIGNED TD %p ALLOCATED UNALIGNED ED %p usb-ohci: exceeded MAX_SAFE buffersalloc_safe_buffer() index %d, ptr %p find_safe_buffer(%p) found @ %d free_safe_buffer(%p) index %d, size_index %d usb-ohci: free_safe_buffer() corrupt buffer ohci_pci_map_single(hwdev=%p,ptr=%p,size=%d,dir=%x) alloced=%ld unable to map unsafe buffer %p! unsafe buffer %p (phy=%p) mapped to %p (phy=%p) ohci_pci_unmap_single(hwdev=%p,ptr=%p,size=%d,dir=%x) alloced=%ld copyback unsafe %p, safe %p, size %d usb-ohci.c: %s URB: no dev usb-ohci.c: %s URB:[%4x] dev:%2d,ep:%2d-%c,type:%s,flags:%4x,len:%d/%d,stat:%d(%x) INTRISOCCTRLBULK%s branch int %2d(%2x): ed: table %p, ed %p info %08x; usb-ohci.c: %s: 0x%08x%s%s%s%s%s%s%s%s%s MIE OC RHSC FNO UE RD SF WDH SOusb-ohci.c: %s %08x td: %p (phys %p) hwINFO %08x, hwCBP %08x, hwBE %08x, hwNextTD %08x index %d, ed %p, next_dl_td %p, urb %p ed: %p (phys %p) hwINFO %08x, hwHeadP %08x, hwTailP %08x hwNextED %08x, ed_prev %p int period %d, branch %d, load %d, interval %d state %d, type %d, last_iso %d hwHeadPresetresumeoperationalsuspend?usb-ohci.c: spec %d.%d usb-ohci.c: control: 0x%08x%s%s%s HCFS=%s%s%s%s%s CBSR=%d RWE RWC IR BLE CLE IE PLEusb-ohci.c: cmdstatus: 0x%08x SOC=%d%s%s%s%s OCR BLF CLF HCRintrstatusintrenableed_periodcurrented_controlheaded_controlcurrented_bulkheaded_bulkcurrentdoneheaded_rm_list %p, %p; disabled %d usb-ohci.c: roothub.a: %08x POTPGT=%d%s%s%s%s%s NDP=%d NOCP OCPM DT NPS PSMusb-ohci.c: roothub.b: %08x PPCM=%04x DR=%04x usb-ohci.c: roothub.status: %08x%s%s%s%s%s%s CRWE OCIC LPSC DRWE OCI LPSusb-ohci.c: roothub.portstatus [%d] = 0x%08x%s%s%s%s%s%s%s%s%s%s%s%s PRSC PSSC PESC CSC LSDA PPS PRS POCI PSS PES CCSusb-ohci.c: OHCI controller usb-%s state hccausb-ohci.c: hcca frame #%04x <3>usb-ohci.c: bug in call from %p; use async! <3>usb-ohci.c: unlink URB timeout <4>usb-ohci.c: TD leak, %d <3>usb-ohci.c: free device %d timeout <3>usb-ohci.c: bus %s devnum %d deletion in interrupt usb-ohci.c<3>usb-ohci.c: internal OHCI error: TD index > length td_fill() hwCBP %p, a20! td_submit_urb() data %p (dma %08x) td_submit_urb() ctrl %p (dma %08x) CC_STALL (tdINFO %x, hwINFO %x) hwCBP %08x, hwBE %08x %02x %02x %02x %02x %02x %02x %02x %02x <3>usb-ohci.c: bogus NDP=%d for OHCI usb-%s <3>usb-ohci.c: rereads as NDP=%d OHCI<3>usb-ohci.c: USB HC TakeOver failed! <3>usb-ohci.c: USB HC reset timed out! <3>usb-ohci.c: OHCI Unrecoverable Error, controller usb-%s disabled %d<6>usb-ohci.c: USB OHCI at membase 0x%lx, IRQ %s <6>usb-ohci.c: usb-%s, %s <3>usb-ohci.c: request interrupt %s failed <3>usb-ohci.c: can't start usb-%s <3>usb-ohci.c: Error mapping OHCI memory  /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value socket:43sockfs[%lu]<3>socki_lookup: socket file changed! <3>sock_release: fasync list not empty! <7>sock_close: NULL inode <6>%s uses obsolete (PF_INET,SOCK_PACKET) <4>socket: no more sockets <2>protocol %d >= NPROTO(%d) <6>Linux NET4.0 for Linux 2.4 <6>Based upon Swansea University Computer Society NET3.039 sockets: used %d /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <7>sk_free: optmem leakage (%d bytes) detected. sock<2>sk_init: Cannot create sock SLAB cache!/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value skput:over: %p:%d put:%d dev:%sskbuff.cskput:under: %p:%d put:%d dev:%s<3>alloc_skb called nonatomically from interrupt %p <4>Warning: kfree_skb passed an skb still on a list (from %p). <4>Warning: kfree_skb on hard IRQ %p skbuff_head_cachecannot create skbuff cache/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hhot_list_lengthoptmem_maxmessage_burstmessage_costmod_conglo_congno_congno_cong_threshnetdev_max_backlogrmem_defaultwmem_defaultrmem_maxwmem_max/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h100baseFX100baseTX100baseTAUI10baseTBNCunknown<4>dev_remove_pack: %p not found. RTNL: assertion failed at dev.c(%d):dev_getbyhwaddr <7>%s: default_rebuild_header called -- BUG! NULL!!!<7>protocol %04x is buggy, dev %s <7>Virtual device %s asks to queue packet! <7>Dead loop on virtual device %s, fix it urgently! KERNEL: assertion (atomic_read(&skb->users) == 0) failed at dev.c(%d):net_tx_action %6s:%8lu %7lu %4lu %4lu %4lu %5lu %10lu %9lu %8lu %7lu %4lu %4lu %4lu %5lu %7lu %10lu %6s: No statistics available. Inter-| Receive | Transmit face |bytes packets errs drop fifo frame compressed multicast|bytes packets errs drop fifo colls carrier compressed %08x %08x %08x %08x %08x %08x %08x %08x %08x RTNL: assertion failed at dev.c(%d):netdev_set_master <6>device %s %s promiscuous mode enteredleft<6>early initialization of device %s is deferred KERNEL: assertion (dev->ip_ptr==NULL) failed at dev.c(%d):netdev_finish_unregister KERNEL: assertion (dev->ip6_ptr==NULL) failed at dev.c(%d):netdev_finish_unregister KERNEL: assertion (dev->dn_ptr==NULL) failed at dev.c(%d):netdev_finish_unregister <3>Freeing alive device %p, %s KERNEL: assertion (dev->deadbeaf==0) failed at dev.c(%d):unregister_netdevice <7>unregister_netdevice: device %s/%p never was registered KERNEL: assertion (dev->master==NULL) failed at dev.c(%d):unregister_netdevice <0>unregister_netdevice: waiting for %s to become free. Usage count = %d devnet/softnet_stat/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hdev_mc_discard: multicast leakage! dmi_users=%d %-4d %-15s %-5d %-5d %02x net/dev_mcast/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hDestroying alive neighbour %p from %08lx Impossible event. neigh: timer & !nud_in_timer neigh_resolve_output: dst=%p neigh=%p neigh_parms_release: not found <2>neighbour leakage netneighdefaultgc_thresh3gc_thresh2gc_thresh1gc_intervallocktimeproxy_delayanycast_delayproxy_qlenunres_qlengc_stale_timedelay_first_probe_timebase_reachable_timeretrans_timeapp_solicitucast_solicitmcast_solicit/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<4>NET: %d messages suppressed. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>%s: unable to resolve type %X addresses. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h802.3/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>Dead loop on netdevice %s, fix it urgently! <6>NETDEV WATCHDOG: %s: transmit timed out <7>%s deferred output. It is buggy. <6>%s: activation failed KERNEL: assertion (dev->qdisc_list == NULL) failed at sch_generic.c(%d):dev_shutdown KERNEL: assertion (!timer_pending(&dev->watchdog_timer)) failed at sch_generic.c(%d):dev_shutdown /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value %d.%d.%d.%d/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value %-127s Iface Destination Gateway Flags RefCnt Use Metric Source MTU Window IRTT TOS HHRef HHUptod SpecDst%s %08lX %08lX %8X %d %u %d %08lX %d %u %u %02X %d %1d %08X*dst cache overflow Neighbour table overflow. <7>rt_bind_peer(0) @%p <7>ip_rt_bug: %u.%u.%u.%u -> %u.%u.%u.%u, %s ?<2>Bug in ip_route_input_slow(). Please, report min_adv_mssmin_pmtumtu_expiresgc_elasticityerror_bursterror_costredirect_silenceredirect_numberredirect_loadgc_intervalgc_timeoutgc_min_intervalmax_sizegc_threshmax_delaymin_delayfluship_dst_cacheIP: failed to allocate ip_dst_cache Failed to allocate IP route cache hash table IP: routing cache hash table of %u buckets, %ldKbytes rt_cache/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hinet_peer_cacheinetpeer.c/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value TCP: inuse %d orphan %d tw %d alloc %d mem %d UDP: inuse %d RAW: inuse %d FRAG: inuse %d memory %d Ip: Forwarding DefaultTTL InReceives InHdrErrors InAddrErrors ForwDatagrams InUnknownProtos InDiscards InDelivers OutRequests OutDiscards OutNoRoutes ReasmTimeout ReasmReqds ReasmOKs ReasmFails FragOKs FragFails FragCreates Ip: %d %d %lu Icmp: InMsgs InErrors InDestUnreachs InTimeExcds InParmProbs InSrcQuenchs InRedirects InEchos InEchoReps InTimestamps InTimestampReps InAddrMasks InAddrMaskReps OutMsgs OutErrors OutDestUnreachs OutTimeExcds OutParmProbs OutSrcQuenchs OutRedirects OutEchos OutEchoReps OutTimestamps OutTimestampReps OutAddrMasks OutAddrMaskReps Icmp: Tcp: RtoAlgorithm RtoMin RtoMax MaxConn ActiveOpens PassiveOpens AttemptFails EstabResets CurrEstab InSegs OutSegs RetransSegs InErrs OutRsts Tcp: Udp: InDatagrams NoPorts InErrors OutDatagrams Udp: TcpExt: SyncookiesSent SyncookiesRecv SyncookiesFailed EmbryonicRsts PruneCalled RcvPruned OfoPruned OutOfWindowIcmps LockDroppedIcmps TW TWRecycled TWKilled PAWSPassive PAWSActive PAWSEstab DelayedACKs DelayedACKLocked DelayedACKLost ListenOverflows ListenDrops TCPPrequeued TCPDirectCopyFromBacklog TCPDirectCopyFromPrequeue TCPPrequeueDropped TCPHPHits TCPHPHitsToUser TCPPureAcks TCPHPAcks TCPRenoRecovery TCPSackRecovery TCPSACKReneging TCPFACKReorder TCPSACKReorder TCPRenoReorder TCPTSReorder TCPFullUndo TCPPartialUndo TCPDSACKUndo TCPLossUndo TCPLoss TCPLostRetransmit TCPRenoFailures TCPSackFailures TCPLossFailures TCPFastRetrans TCPForwardRetrans TCPSlowStartRetrans TCPTimeouts TCPRenoRecoveryFail TCPSackRecoveryFail TCPSchedulerFailed TCPRcvCollapsed TCPDSACKOldSent TCPDSACKOfoSent TCPDSACKRecv TCPDSACKOfoRecv TCPAbortOnSyn TCPAbortOnData TCPAbortOnClose TCPAbortOnMemory TCPAbortOnTimeout TCPAbortOnLinger TCPAbortFailed TCPMemoryPressures TcpExt:/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value TCPUDPICMP/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<6>source route option %u.%u.%u.%u -> %u.%u.%u.%u /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hKERNEL: assertion (qp->last_in&COMPLETE) failed at ip_fragment.c(%d):ip_frag_destroy KERNEL: assertion (del_timer(&qp->timer) == 0) failed at ip_fragment.c(%d):ip_frag_destroy <3>ip_frag_create: no memory left ! KERNEL: assertion (head != NULL) failed at ip_fragment.c(%d):ip_frag_reasm KERNEL: assertion (FRAG_CB(head)->offset == 0) failed at ip_fragment.c(%d):ip_frag_reasm <3>IP: queue_glue: no memory for gluing queue %p <6>Oversized IP packet from %d.%d.%d.%d. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<2>ip_forward(): Argh! Destination lost! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (newskb->dst) failed at ip_output.c(%d):ip_dev_loopback_xmit <7>khm <7>sending pkt_too_big to self <6>IP: frag: no memory for new fragment! /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (lopt->qlen == 0) failed at tcp.c(%d):tcp_listen_stop KERNEL: assertion (child->lock.users==0) failed at tcp.c(%d):tcp_listen_stop KERNEL: assertion (sk->ack_backlog == 0) failed at tcp.c(%d):tcp_listen_stop <6>recvmsg bug: copied %X seq %X KERNEL: assertion (tp->copied_seq == tp->rcv_nxt || (flags&(MSG_PEEK|MSG_TRUNC))) failed at tcp.c(%d):tcp_recvmsg KERNEL: assertion (skb_queue_empty(&sk->write_queue)) failed at tcp.c(%d):tcp_kill_sk_queues KERNEL: assertion (sk->wmem_queued == 0) failed at tcp.c(%d):tcp_kill_sk_queues KERNEL: assertion (sk->forward_alloc == 0) failed at tcp.c(%d):tcp_kill_sk_queues KERNEL: assertion (sk->state==TCP_CLOSE) failed at tcp.c(%d):tcp_destroy_sock KERNEL: assertion (sk->dead) failed at tcp.c(%d):tcp_destroy_sock KERNEL: assertion (sk->pprev==NULL) failed at tcp.c(%d):tcp_destroy_sock KERNEL: assertion (!sk->num || sk->prev!=NULL) failed at tcp.c(%d):tcp_destroy_sock TCP: double destroy sk=%p KERNEL: assertion (sk->lock.users==0) failed at tcp.c(%d):tcp_close <6>TCP: too many of orphaned sockets KERNEL: assertion (!sk->num || sk->prev) failed at tcp.c(%d):tcp_disconnect KERNEL: assertion (newsk->state != TCP_SYN_RECV) failed at tcp.c(%d):tcp_accept tcp_open_requesttcp_init: Cannot alloc open_request cache.tcp_bind_buckettcp_init: Cannot alloc tcp_bind_bucket cache.tcp_tw_buckettcp_init: Cannot alloc tcp_tw_bucket cache.Failed to allocate TCP established hash table Failed to allocate TCP bind hash table TCP: Hash tables configured (established %d bind %d) /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion ((int)tp->sacked_out >= 0) failed at tcp_input.c(%d):tcp_sacktag_write_queue KERNEL: assertion ((int)tp->lost_out >= 0) failed at tcp_input.c(%d):tcp_sacktag_write_queue KERNEL: assertion ((int)tp->retrans_out >= 0) failed at tcp_input.c(%d):tcp_sacktag_write_queue KERNEL: assertion ((int)tcp_packets_in_flight(tp) >= 0) failed at tcp_input.c(%d):tcp_sacktag_write_queue KERNEL: assertion (tp->lost_out == 0) failed at tcp_input.c(%d):tcp_remove_reno_sacks KERNEL: assertion (cnt <= tp->packets_out) failed at tcp_input.c(%d):tcp_mark_head_lost KERNEL: assertion (tp->retrans_out == 0) failed at tcp_input.c(%d):tcp_fastretrans_alert KERNEL: assertion ((int)tp->sacked_out >= 0) failed at tcp_input.c(%d):tcp_clean_rtx_queue KERNEL: assertion ((int)tp->lost_out >= 0) failed at tcp_input.c(%d):tcp_clean_rtx_queue KERNEL: assertion ((int)tp->retrans_out >= 0) failed at tcp_input.c(%d):tcp_clean_rtx_queue <7>Leak l=%u %d <7>Leak s=%u %d <7>Leak r=%u %d <7>TCP: peer %u.%u.%u.%u:%u/%u shrinks window %u:%u:%u. Bad, what else can I say? <7>Ack %u out of %u:%u tcp_parse_options: Illegal window scaling value %d >14 received.tcp_fin: Impossible, sk->state=%d KERNEL: assertion (!before(tp->rcv_nxt, sp->end_seq)) failed at tcp_input.c(%d):tcp_sack_remove <7>ofo packet was already received <7>ofo requeuing : rcv_next %X seq %X - %X BUG: retransmit in tcp_data_queue: seq %X <7>partial packet: rcv_next %X seq %X - %X <7>out of order segment: rcv_next %X seq %X - %X <7>prune_queue: c=%x <7>*** tcp.c:tcp_data bug acked < copied /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <7>retrans_out leaked. <7>tcp_send_synack: wrong queue state /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <7>tcpbug: unknown timer value <6>Out of socket memory KERNEL: assertion (!skb_queue_empty(&sk->write_queue)) failed at tcp_timer.c(%d):tcp_retransmit_timer /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (sk->prev == (struct sock *) tb) failed at tcp_ipv4.c(%d):tcp_v4_get_port KERNEL: assertion (sk->pprev==NULL) failed at tcp_ipv4.c(%d):__tcp_v4_hash KERNEL: assertion (sk->pprev==NULL) failed at tcp_ipv4.c(%d):tcp_v4_check_established KERNEL: assertion (req->sk == NULL) failed at tcp_ipv4.c(%d):tcp_v4_search_req KERNEL: assertion (req->sk == NULL) failed at tcp_ipv4.c(%d):tcp_v4_err <6>possible SYN flooding on port %d. Sending cookies. <7>TCP: drop open request from %u.%u.%u.%u/%u <7>hw tcp v4 csum failed <4>tcp_v4_rebuild_header(): not valid sock addrs: saddr=%08X rcv_saddr=%08X <6>tcp_v4_rebuild_header(): shifting sk->saddr from %d.%d.%d.%d to %d.%d.%d.%d %4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08X %08X %5d %8d %u %d %p%4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %lu %d %p %u %u %u %u %d%4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08X %08X %5d %8d %d %d %p%-*s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inodeFailed to create the TCP control socket. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (sk->prev!=NULL) failed at tcp_minisocks.c(%d):__tcp_tw_hashdance <6>TCP: time wait bucket table overflow /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<6>%s forgot to set AF_INET in raw sendmsg. Fix it! %4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %ld %d %p%-127s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inode/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hudp.c<7>UDP: short packet: %d/%d <7>UDP: bad checksum. From %d.%d.%d.%d:%d to %d.%d.%d.%d:%d ulen %d %4d: %08X:%04X %08X:%04X %02X %08X:%08X %02X:%08lX %08X %5d %8d %ld %d %p%-127s sl local_address rem_address st tx_queue rx_queue tr tm->when retrnsmt uid timeout inode/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value arp_cache<7>trying to ucast probe in NUD_INVALID <7>ARP: arp called for own IP address <7>arp_find is called with dst==NULL 0123456789ABCDEFIP address HW type Flags HW address Mask Device %u.%u.%u.%u%-16s 0x%-10x0x%-10x%s * %s 00:00:00:00:00:00*arpipv4/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value <6>ICMP: %u.%u.%u.%u: fragmentation needed and DF set. <6>ICMP: %u.%u.%u.%u: Source Route Failed. <4>%u.%u.%u.%u sent an invalid ICMP error to a broadcast. <6>Wrong address mask %u.%u.%u.%u from %s/%u.%u.%u.%u Failed to create the ICMP control socket. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hKERNEL: assertion (idev->ifa_list==NULL) failed at devinet.c(%d):in_dev_finish_destroy KERNEL: assertion (idev->mc_list==NULL) failed at devinet.c(%d):in_dev_finish_destroy Freeing alive in_device %p RTNL: assertion failed at devinet.c(%d):inetdev_init ipv4RTNL: assertion failed at devinet.c(%d):inetdev_destroy RTNL: assertion failed at devinet.c(%d):inet_del_ifa RTNL: assertion failed at devinet.c(%d):inet_insert_ifa RTNL: assertion failed at devinet.c(%d):inet_set_ifa KERNEL: assertion (ifa->ifa_dev==NULL) failed at devinet.c(%d):inet_set_ifa RTNL: assertion failed at devinet.c(%d):inet_ifa_byprefix RTNL: assertion failed at devinet.c(%d):inetdev_event <7>inetdev_event: bug netconfalltaglog_martiansbootp_relayproxy_arpaccept_source_routesend_redirectsrp_filtershared_mediasecure_redirectsaccept_redirectsmc_forwardingforwardingdefault/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value Attempt to release TCP socket in state %d %p Attempt to release alive inet socket %p KERNEL: assertion (atomic_read(&sk->rmem_alloc) == 0) failed at af_inet.c(%d):inet_sock_destruct KERNEL: assertion (atomic_read(&sk->wmem_alloc) == 0) failed at af_inet.c(%d):inet_sock_destruct KERNEL: assertion (sk->wmem_queued == 0) failed at af_inet.c(%d):inet_sock_destruct KERNEL: assertion (sk->forward_alloc == 0) failed at af_inet.c(%d):inet_sock_destruct KERNEL: assertion ((1<state)&(TCPF_ESTABLISHED|TCPF_CLOSE_WAIT|TCPF_CLOSE)) failed at af_inet.c(%d):inet_accept <6>NET4: Linux TCP/IP 1.0 for NET4.0 <2>inet_proto_init: panic <6>IP Protocols: %s%s, rawnetstatsnmpsockstattcpudp/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hRTNL: assertion failed at igmp.c(%d):ip_mc_inc_group RTNL: assertion failed at igmp.c(%d):ip_mc_dec_group RTNL: assertion failed at igmp.c(%d):ip_mc_down RTNL: assertion failed at igmp.c(%d):ip_mc_up RTNL: assertion failed at igmp.c(%d):ip_mc_destroy_dev /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value tcp_adv_win_scaletcp_app_wintcp_rmemtcp_wmemtcp_memtcp_dsacktcp_reorderingtcp_facktcp_orphan_retriesinet_peer_gc_maxtimeinet_peer_gc_mintimeinet_peer_maxttlinet_peer_minttlinet_peer_thresholdrouteicmp_echoreply_rateicmp_paramprob_rateicmp_timeexceed_rateicmp_destunreach_rateicmp_ignore_bogus_error_responsesicmp_echo_ignore_broadcastsicmp_echo_ignore_allip_local_port_rangetcp_max_syn_backlogtcp_rfc1337tcp_stdurgtcp_abort_on_overflowtcp_tw_recycletcp_fin_timeouttcp_retries2tcp_retries1tcp_keepalive_intvltcp_keepalive_probestcp_keepalive_timeipfrag_timeip_dynaddripfrag_low_threshipfrag_high_threshtcp_max_tw_bucketstcp_max_orphanstcp_synack_retriestcp_syn_retriesip_nonlocal_bindip_no_pmtu_discip_autoconfigip_default_ttlip_forwardtcp_retrans_collapsetcp_sacktcp_window_scalingtcp_timestamps/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value %-127s Iface Destination Gateway Flags RefCnt Use Metric Mask MTU Window IRTT<7>fib_add_ifaddr: bug: prim == NULL <7>fib_del_ifaddr: bug: prim == NULL route/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value Freeing alive fib_info %p <7>impossible 102 %s %08X %08X %04X %d %u %d %08X %d %u %u** %08X %08X %04X %d %u %d %08X %d %u %u/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value ip_fib_hash/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hdummy<4>BOOTP: Ignoring device %s, MTU %d too small<3>IP-Config: Failed to open %s <3>IP-Config: Device `%s' not found. <3>IP-Config: No network devices available. <3>IP-Config: Unable to set interface address (%d). <3>IP-Config: Unable to set interface netmask (%d). <3>IP-Config: Unable to set interface broadcast address (%d). <3>IP-Config: Gateway not on directly connected network. <3>IP-Config: Cannot add default route (%d). <3>IP-Config: Unable to guess netmask for address %u.%u.%u.%u IP-Config: Guessing netmask %u.%u.%u.%u Unknown ARP type 0x%04x for device %s E<3>BOOTP: Ignoring fragmented reply. ?<3>IP-Config: Incomplete network configuration information. <3>BOOTP: No suitable device found. <5>Sending %s%s%s requests...BOOTP and RARP. OK timed out! IP-Config: Got %s answer from %u.%u.%u.%u, my address is %u.%u.%u.%u <3>IP-Config: Auto-configuration of network failed. offbootpboth/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value KERNEL: assertion (sk->protinfo.af_unix.list==NULL) failed at af_unix.c(%d):__unix_insert_socket KERNEL: assertion (atomic_read(&sk->wmem_alloc) == 0) failed at af_unix.c(%d):unix_sock_destructor KERNEL: assertion (sk->protinfo.af_unix.list==NULL) failed at af_unix.c(%d):unix_sock_destructor KERNEL: assertion (sk->socket==NULL) failed at af_unix.c(%d):unix_sock_destructor Attempt to release alive unix socket: %p %05xNum RefCount Protocol Flags Type St Inode Path %p: %08X %08X %08X %04X %02X %5ld<6>NET4: Unix domain sockets 1.0/SMP for Linux NET4.0. <2>unix_proto_init: panic net/unix/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.h<7>reset_xmit_timer sk=%p %d when=0x%lx, caller=%p <7>bug: unknown timer value /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hmax_dgram_qlennetunix/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknownRPC: creating %s client for %s (xprt %p) bindwaith4<6>RPC: out of memory in rpc_create_client <6>RPC: Couldn't create auth handle (flavor %d) RPC: shutting down %s client for %s RPC: rpc_shutdown_client: client %s, tasks=%d RPC: destroying %s client for %s RPC: rpc_release_client(%p, %d) rpc_call_sync: Illegal flag combination for synchronous task <4>%s (vers %d): bad procedure number %d RPC: %4d call_reserve RPC: %4d call_reserveresult (status %d) <3>call_reserveresult: status=%d, request=%p?? RPC: task timed out <6>RPC: task has no request, exit EIO RPC: %4d call_allocate (status %d) <6>RPC: buffer allocation failed for task %p RPC: %4d call_encode (status %d) <6>RPC: call_header failed, exit EIO <4>%s: can't encode arguments: %d RPC: %4d call_reconnect status %d RPC: %4d call_transmit (status %d) RPC: %4d call_status (status %d) %s: RPC call returned error %d RPC: %4d call_timeout (minor timeo) RPC: %4d call_timeout (major timeo) <5>%s: server %s not responding, timed out <5>%s: server %s not responding, still trying <5>%s: task %d can't get a request slot RPC: %4d call_decode (status %d) <5>%s: server %s OK <4>%s: too small RPC reply size (%d bytes) RPC: %4d retry squashed uid RPC: %4d call_decode result %d RPC: %4d call_refresh RPC: %4d call_refreshresult (status %d) <4>call_verify: not an RPC reply: %x <4>call_verify: RPC call rejected: %x RPC: %4d call_verify: retry stale creds RPC: %4d call_verify: retry garbled creds <5>call_verify: server requires stronger authentication. <4>call_verify: unknown auth error: %x RPC: %4d call_verify: call rejected %d <4>call_verify: auth check failed <4>call_verify: server accept status: %x RPC: %4d call_verify: server saw garbage <4>RPC: garbage, retrying %4d <4>RPC: garbage, exit EIO /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/file.hpacket data:RPC: xprt_sendmsg(%d) = %d <5>RPC: sendmsg returned error %d RPC: xprt_recvmsg(iov %p, len %d) = %d RPC: cong %08lx, cwnd was %08lx, now %08lx, time %ld ms RPC: cong %ld, cwnd was %ld, now %ld, time %ld ms <4>xprt_adjust_timeout: to_current = 0! RPC: disconnected transport %p RPC: %4d xprt_reconnect %p connected %d RPC: %4d connecting new socket RPC: TCP connect error %d! RPC: %4d connect status %d connected %d RPC: %4d xprt_reconn_timeout %d xprt_lookup_rqst: loop in Q! RPC: unknown XID %08x in reply. RPC: %4d has input (%d bytes) RPC: udp_data_ready... RPC: udp_data_ready request not found! RPC: udp_data_ready client %p RPC: impossible RPC reply size %d! RPC: %4d received reply RPC: reading header (%d bytes) RPC: New record reclen %d morefrags %d RPC: reading xid (%d bytes) RPC: %4d TCP receiving %d bytes RPC: %4d received reply complete RPC: TCP skipping %d bytes RPC: tcp_input_record RPC: tcp_input_record done (off %d reclen %d copied %d) RPC: xprt queue %p rpciod_tcp_dispatcher: Queue Running rpciod_tcp_dispatcher: Processing %p RPC: tcp_data_ready... Not a socket with xprt %p RPC: tcp_data_ready client %p RPC: state %x conn %d dead %d zapped %d RPC: tcp_state_change client %p... RPC: %4d xprt_timer (%s request) pendingbackloggedRPC: %4d TCP write queue full (task %d) RPC: %4d xprt_transmit(%x) RPC: %4d xmit incomplete (%d left of %d) RPC: %4d xmit complete RPC: %4d xprt_receive RPC: %4d xprt_reserve cong = %ld cwnd = %ld RPC: xprt_reserve waiting on backlog RPC: %4d xprt_reserve returns %d RPC: %4d reserved req %p xid %08x RPC: %4d release request %p RPC: task of released request still queued! RPC: setting up %s transport... UDPTCPxprt_pending0y4xprt_sendingHy4xprt_backlog`y4xprt_reconnxy4RPC: created transport %p RPC: Can't bind to reserved port (%d). RPC: xprt_create_socket(%s %d) udptcpRPC: can't create socket (%d). RPC: xprt_create_proto called RPC: destroying transport %p /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknownschedqchildqdelayqRPC: %4d disabling timer RPC: %4d running timer RPC: %4d setting alarm for %lu ms RPC: %4d deleting timer <4>RPC: doubly enqueued task! RPC: %4d added to queue %p "%s" RPC: %4d removed from queue %p "%s" <3>RPC: task w/ running timer in rpc_make_runnable!! <4>RPC: failed to add task to queue: error: %d! <3>rpciod: wot no daemon? RPC: %4d sleep_on(queue "%s" time %ld) <3>RPC: Inactive synchronous task put to sleep! <3>RPC: %4d overwrites an active callback sched.cRPC: %4d __rpc_wake_up_task (now %ld inh %d) <3>RPC: attempt to wake up non-existing task! <3>RPC: Inactive task (%p) being woken up! RPC: __rpc_wake_up_task done RPC: %d timeout (default timer) RPC: wake_up_next(%p "%s") RPC: %4d rpc_execute flgs %x <4>RPC: rpc_execute called for sleeping task!! RPC: %4d sync task going to sleep <3>RPC: rpciod waiting on sync task! RPC: %4d sync task resuming RPC: %4d got signal <3>RPC: dead task tries to walk away. RPC: %4d exit() = %d <6>RPC: execution inhibited! <3>RPC: active task was run twice! RPC: rpc_schedule enter <3>RPC: Locked task was scheduled !!!! RPC: rpc_schedule leave RPC: allocated buffer %p RPC: used last-ditch swap buffer RPC: %4d new task procpid %d RPC: %4d freeing task RPC: %4d allocated task rpc_new_task: failed, users=%d, oneshot=%d RPC: %4d release task <3>RPC: attempt to release a non-existing task! RPC: killing all tasks for client %p rpciodRPC: rpciod starting (pid %d) RPC: rpciod back to sleep RPC: switch to rpciod RPC: rpciod shutdown commences <3>rpciod: active tasks at shutdown?! RPC: rpciod exiting rpciod_killall: waiting for tasks to exit rpciod_up: pid %d, users %d <4>rpciod_up: no pid, %d users?? <4>rpciod_up: create thread failed, error=%d rpciod_down pid %d sema %d <4>rpciod_down: pid=%d, no users?? rpciod_down: Nothing to do! rpciod_down: waiting for pid %d to exit rpciod_down: caught signal -pid- proc flgs status -client- -prog- --rqstp- -timeout -rpcwait -action- --exit-- %05d %04d %04x %06d %8p %6d %8p %08ld %8s %8p %8p /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknownauth.cRPC: gc'ing RPC credentials for auth %p RPC: looking up %s cred RPC: %4d looking up %s cred RPC: matching %s cred %d RPC: %4d holding %s cred %p RPC: %4d releasing %s cred %p RPC: %4d marshaling %s cred %p RPC: %4d validating %s cred %p RPC: %4d refreshing %s cred %p RPC: %4d invalidating %s cred %p /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknownRPC: creating NULL authenticator for client %p RPC: destroying NULL authenticator %p RPC: bad verf flavor: %ld RPC: bad verf size: %ld NULL/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknownRPC: creating UNIX authenticator for client %p RPC: destroying UNIX authenticator %p RPC: allocating UNIX cred for uid %d gid %d RPC: allocating fake UNIX cred for uid %d gid %d RPC: bad verf flavor: %ld RPC: giant verf size: %ld UNIX/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknownRPC: svc_destroy(%s, %d) svc_destroy: no threads for serv=%p! RPC: svc_register(%s, %s, %d) udptcpsvc: failed to encode reply svc: calling dispatcher svc: svc_process dropit svc: short len %d, dropping request svc: bad direction %d, dropping request svc: authentication failed (%d) svc: unknown program %d (me %d) svc: unknown version (%d) svc: unknown procedure (%d) svc: failed to decode args /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsvc: service %p, releasing skb %p <3>svc_sock_enqueue: threads and sockets both waiting?? svc: socket %p busy, not enqueued svc: socket %p served by daemon %p <3>svc_sock_enqueue: server %p, rq_sock=%p! svc: socket %p put into queue svc: socket %p dequeued, inuse=%d <5>svc: sk_data negative! svc: socket %p re-enqueued after receive svc: socket %p re-enqueued after accept svc: releasing dead socket svc: daemon %p woken up. svc: socket %p sendto([%p %Zu... ], %d, %d) = %d svc: socket %p recvfrom(%p, %Zu) = %d svc: socket %p(inet %p), count=%d, busy=%d svc: recvfrom returned error %d svc: socket %p TCP (listen) state change %d svc: socket %p: no user data svc: socket %p TCP (connected) state change %d (svsk %p) svc: socket %p TCP data ready (svsk %p) svc: tcp_accept %p sock %p <4>%s: no more sockets! svc: tcp_accept %p allocated <4>%s: accept failed (err %d)! <4>%s: peername failed (err %d)! <4>%s: connect from unprivileged port: %u.%u.%u.%u:%d %s: connect from %u.%u.%u.%u:%04x svc: tcp_recv %p data %d conn %d close %d <5>RPC: bad TCP reclen %08lxsvc: TCP record, %d bytes svc: incomplete TCP record (%d of %d) svc: TCP complete record (%d bytes) RPC: TCP recvfrom got EAGAIN <5>%s: recvfrom returned errno %d <5>rpc-srv/tcp: %s: sent only %d bytes of %d - should shutdown socket setting up TCP socket for listening setting up TCP socket for reading svc: server %p waiting for data (to = %ld) <3>svc_recv: service %p, socket not NULL! <3>svc_recv: service %p, wait queue active! svc: server %p, no data yet svc: server %p, socket %p, inuse=%d svc: got len=%d svc: socket %p dropped request <4>NULL socket pointer in %s:%d svcsock.csvc: svc_setup_socket %p <4>svsk->sk_sk == NULL after svc_prot_init! svc: svc_setup_socket created %p (inet %p) svc: svc_create_socket(%s, %d, %u.%u.%u.%u:%d) <4>svc: only UDP and TCP sockets supported svc: svc_create_socket error = %d svc: svc_delete_socket(%p) <5>svc: server socket destroy delayed svc: creating socket proto = %d /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hsvc: svc_authenticate (%d) svc: bad null cred svc: bad null verf unknown/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hRPC: %4d rpc_getport(%s, %d, %d, %d) RPC: rpc_getport_external(%u.%u.%u.%u, %d, %d, %d) RPC: %4d pmap_getport_done(status %d, port %d) RPC: registering (%d, %d, %d, %d) with portmapper. localhostRPC: couldn't create pmap client <4>RPC: failed to contact portmap (errno %d). RPC: registration status %d/%d RPC: xdr_encode_mapping(%d, %d, %d, %d) pmap_getpmap_unsetpmap_setpmap_nullportmap<7>RPC: Urk! Large shift of short iovec. /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknownnet %d %d %d %d rpc %d %d %d proc%d %d %drpc %d %d %d %d %d RPC: registering /proc/net/rpc/%s RPC: registering /proc/net/rpc net/rpcRPC: unregistering /proc/net/rpc /opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hunknown%dnlm_debugnfsd_debugnfs_debugrpc_debugsunrpc/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.hipv4ethernet802unixcore/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/mount.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/dcache.h/opt/hardhat/devkit/lsp/assabet/tmp/hhl-assabet-lsp-2.4.0-test10-z-1/linux-2.4.0-test10/include/linux/sched.h<4>NetWinder Floating Point Emulator V0.95 (c) 1998-1999 Rebel.com <3>nwfpe: bad structure size <7>NWFPE: %s[%d] takes exception %08x at %p from %08x "]6hE1+2F g - Z))Vy h40123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZenable_dmadisable_dmaset_dma_addrset_dma_countset_dma_modeset_dma_pageget_dma_residueset_dma_sgset_dma_speedleds_eventset_dma_mode_sa1100get_dma_address_sa1100kern_fp_enterfp_printkfp_send_sigkd_mksounddump_threaddump_fpuudelay__ioremap__iounmapkernel_threadsystem_revsystem_serial_lowsystem_serial_highmem_fclk_21285__bug__bad_xchg__readwrite_bugenable_irqdisable_irqpm_idlepm_power_off__machine_arch_typecsum_partial_copy_nocheck__csum_ipv6_magicoutsboutswoutslinsbinswinslquicklists__handle_bad_pmd__handle_bad_pmd_kernelstrcpystrncpystrcatstrncatstrcmpstrncmpstrchrstrlenstrnlenstrpbrkstrtokstrrchrstrstrmemsetmemcpymemmovememcmpmemscan__memzero__arch_copy_from_user__arch_copy_to_user__arch_clear_user__arch_strnlen_userpci_alloc_consistentconsistent_allocconsistent_freeconsistent_sync__gcc_bcmp__ashldi3__ashrdi3__cmpdi2__divdi3__divsi3__lshrdi3__moddi3__modsi3__muldi3__negdi2__ucmpdi2__udivdi3__udivmoddi4__udivsi3__umoddi3__umodsi3set_bittest_and_set_bitclear_bittest_and_clear_bitchange_bittest_and_change_bitfind_first_zero_bitfind_next_zero_bitelf_platformelf_hwcapsys_writesys_readsys_lseeksys_opensys_exitsys_wait4__down_failed__down_interruptible_failed__down_trylock_failed__up_wakeup__down_read_failed__down_write_failed__rwsem_wakeget_wchancpu_sa1100_cache_clean_invalidate_allcpu_sa1100_cache_clean_invalidate_rangecpu_sa1100_flush_ram_pagecpu_sa1100_dcache_clean_pagecpu_sa1100_dcache_clean_entrycpu_sa1100_dcache_clean_rangecpu_sa1100_dcache_invalidate_rangecpu_sa1100_icache_invalidate_rangecpu_sa1100_icache_invalidate_pagecpu_sa1100_tlb_invalidate_allcpu_sa1100_tlb_invalidate_rangecpu_sa1100_tlb_invalidate_pagecpu_sa1100_set_pgdcpu_sa1100_set_pmdcpu_sa1100_set_pteset_GPIO_IRQ_edgeBCR_valueSCR_valuesa1100_request_dmasa1100_dma_set_callbacksa1100_dma_set_devicesa1100_dma_set_spinsa1100_dma_queue_buffersa1100_dma_get_currentsa1100_dma_stopsa1100_dma_resumesa1100_dma_flush_allsa1100_free_dmainit_hwtimeradd_hwtimerdel_hwtimersa1111_sac_request_dmasa1111_check_dma_bugdequeue_signalflush_signalsforce_sigforce_sig_infokill_pgkill_pg_infokill_prockill_proc_infokill_slkill_sl_infonotify_parentrecalc_sigpendingsend_sigsend_sig_infoblock_all_signalsunblock_all_signalsnotifier_chain_registernotifier_chain_unregisternotifier_call_chainregister_reboot_notifierunregister_reboot_notifierin_group_pin_egroup_pschedule_taskget_module_symbolput_module_symboltry_inc_mod_countdo_mmap_pgoffdo_munmapdo_brkexit_mmexit_filesexit_fsexit_sighand__alloc_pagesalloc_pagesalloc_pages_node__get_free_pagesget_zeroed_page__free_pagesfree_pagesdeactivate_pagenum_physpageskmem_find_general_cachepkmem_cache_createkmem_cache_destroykmem_cache_shrinkkmem_cache_allockmem_cache_freekmallockfreevfree__vmallocmem_mapremap_page_rangemax_mapnrhigh_memoryvmtruncatefind_vmaget_unmapped_areainit_mmdef_blk_fopsupdate_atimeget_fs_typeget_superget_empty_supergetnamenames_cachepfputfgetigrabiuniqueiget4iputforce_deletefollow_upfollow_downpath_initpath_walkpath_release__user_walklookup_onelookup_hashsys_closedcache_lockd_alloc_rootd_deletedget_lockedd_validated_rehashd_invalidated_moved_instantiated_allocd_lookup__d_pathmark_buffer_dirty__mark_buffer_dirty__mark_inode_dirtyget_empty_filpinit_private_filefilp_openfilp_closeput_filpfiles_lockcheck_disk_change__invalidate_buffersinvalidate_inodesinvalidate_inode_pagestruncate_inode_pagesfsync_devpermissioninode_setattrinode_change_okwrite_inode_nownotify_changeget_hardblocksizeset_blocksizegetblkbdgetbdputbreadbreada__brelse__bforgetll_rw_block__wait_on_buffer___wait_on_pageblock_write_full_pageblock_read_full_pageblock_prepare_writeblock_sync_pagecont_prepare_writegeneric_commit_writeblock_truncate_pagegeneric_block_bmapgeneric_file_readdo_generic_file_readgeneric_file_writegeneric_file_mmapgeneric_ro_fopsgeneric_buffer_fdatasyncpage_hash_bitspage_hash_tablefile_lock_listfile_lock_semlocks_init_locklocks_copy_lockposix_lock_fileposix_test_lockposix_block_lockposix_unblock_locklocks_mandatory_areadputhave_submountsd_find_aliasd_prune_aliasesprune_dcacheshrink_dcache_sbshrink_dcache_parentfind_inode_numberis_subdirget_unused_fdvfs_createvfs_mkdirvfs_mknodvfs_symlinkvfs_linkvfs_rmdirvfs_unlinkvfs_renamevfs_statfsgeneric_read_dir__pollwaitpoll_freewaitROOT_DEV__find_lock_pagegrab_cache_pageread_cache_pagevfs_readlinkvfs_follow_linkpage_readlinkpage_follow_linkpage_symlink_inode_operationsblock_symlinkvfs_readdir__get_leaselease_get_mtimelock_may_readlock_may_writedcache_readdirdefault_llseekdentry_openfilemap_nopagefilemap_swapoutfilemap_synclock_pageregister_chrdevunregister_chrdevregister_blkdevunregister_blkdevtty_register_drivertty_unregister_drivertty_std_termiosblock_readblock_writeblksize_sizehardsect_sizeblk_sizeblk_devis_read_onlyset_device_robmapsync_devdevfs_register_partitionsblkdev_openblkdev_getblkdev_putioctl_by_bdevgendisk_headgrok_partitionsregister_disktq_diskinit_bufferrefile_buffermax_sectorsmax_readaheadfile_movetotty_hanguptty_wait_until_senttty_check_changetty_hung_up_ptty_flip_buffer_pushtty_get_baud_ratedo_SAKconsole_printconsole_loglevelregister_filesystemunregister_filesystemkern_mountkern_umountmay_umountregister_binfmtunregister_binfmtsearch_binary_handlerprepare_binprmcompute_credsremove_arg_zeroset_binfmtregister_exec_domainunregister_exec_domain__set_personalityregister_sysctl_tableunregister_sysctl_tablesysctl_stringsysctl_intvecproc_dostringproc_dointvecproc_dointvec_jiffiesproc_dointvec_minmaxproc_doulongvec_ms_jiffies_minmaxproc_doulongvec_minmaxadd_timerdel_timerrequest_irqfree_irqirq_statadd_wait_queueadd_wait_queue_exclusiveremove_wait_queueprobe_irq_onprobe_irq_offmod_timertq_timertq_immediatetq_schedulerkiobuf_initalloc_kiovecfree_kiovecexpand_kiobufmap_user_kiobufunmap_kiobuflock_kiovecunlock_kiovecbrw_kiovecrequest_dmafree_dmadma_spin_lockrequest_resourcerelease_resourceallocate_resourcecheck_resource__request_region__check_region__release_regionioport_resourceiomem_resource__wake_upwake_up_processsleep_onsleep_on_timeoutinterruptible_sleep_oninterruptible_sleep_on_timeoutscheduleschedule_timeoutjiffiesxtimedo_gettimeofdaydo_settimeofdayloops_per_seckstatnr_runningpanicprintksprintfvsprintfkdevnamebdevnamecdevnamesimple_strtoulsystem_utsnameuts_semsys_call_tablemachine_restartmachine_haltmachine_power_off_ctypesecure_tcp_sequence_numberget_random_bytessecurebitscap_bsetdaemonizesetup_arg_pagescopy_strings_kerneldo_execveflush_old_execkernel_readopen_execsi_meminfosys_tz__wait_on_superfile_fsyncclear_inodenr_async_pages___strtokinit_special_inoderead_aheadget_hash_tableget_empty_inodeinsert_inode_hashremove_inode_hashmake_bad_inodeis_bad_inodeevent__down__down_interruptible__down_trylock__upbrw_pageoverflowuidoverflowgidfs_overflowuidfs_overflowgidfasync_helperkill_fasyncdisk_nameget_write_accessregister_consoleunregister_consoleget_fast_timestrnicmpstrspnstrseptasklet_hi_vectasklet_vecbh_task_vecinit_bhremove_bhtasklet_inittasklet_killinit_task_uniontasklist_lockpidhashproc_sys_rootproc_symlinkproc_mknodproc_mkdircreate_proc_entryremove_proc_entryproc_rootproc_root_fsproc_netproc_busproc_root_driverlockd_uplockd_downnlmclnt_procnlmsvc_invalidate_clientnlmsvc_opsnlmsvc_grace_periodnlmsvc_timeoutio_request_lockend_that_request_firstend_that_request_lastblk_init_queueblk_get_queueblk_cleanup_queueblk_queue_headactiveblk_queue_pluggableblk_queue_make_requestgeneric_make_requestblkdev_release_requestblk_ioctltty_register_devfstty_unregister_devfsmisc_registermisc_deregisteradd_keyboard_randomnessadd_mouse_randomnessadd_interrupt_randomnessadd_blkdev_randomnessbatch_entropy_storecolor_tabledefault_reddefault_grndefault_bluvideo_font_heightvideo_scan_linesvc_resizefg_consoleconsole_blank_hookvt_constake_over_consolegive_up_consoleset_selectionpaste_selectionhandle_scancodekbd_ledfunckeyboard_taskletsysrq_power_offei_openei_closeei_interruptethdev_initNS8390_initautoirq_setupautoirq_reportide_auto_reduce_xferide_driveid_updateide_ata66_checkset_transfereighty_ninty_threeide_config_drive_speedide_hwifside_register_moduleide_unregister_moduleide_spin_wait_hwgroupide_probedrive_is_flashcardide_timer_expiryide_intride_fopside_get_queueide_add_generic_settingside_devfs_handledo_ide_requestide_scan_deviceside_register_subdriveride_unregister_subdriveride_replace_subdriveride_input_dataide_output_dataatapi_input_bytesatapi_output_byteside_set_handleride_dump_statuside_erroride_fixstringide_wait_statide_do_resetide_init_drive_cmdide_do_drive_cmdide_end_drive_cmdide_end_requestide_revalidate_diskide_cmdide_wait_cmdide_wait_cmd_taskide_delay_50mside_stall_queueide_add_proc_entrieside_remove_proc_entriesproc_ide_read_geometrycreate_proc_ide_interfaceside_add_settingide_remove_settingide_register_hwide_registeride_unregisteride_setup_portshwif_unregisterget_info_ptrcurrent_capacitysystem_bus_clockregister_pccard_driverunregister_pccard_driverpcmcia_access_configuration_registerpcmcia_adjust_resource_infopcmcia_bind_devicepcmcia_bind_mtdpcmcia_check_erase_queuepcmcia_close_memorypcmcia_copy_memorypcmcia_deregister_clientpcmcia_deregister_erase_queuepcmcia_eject_cardpcmcia_get_first_clientpcmcia_get_card_services_infopcmcia_get_configuration_infopcmcia_get_mem_pagepcmcia_get_next_clientpcmcia_get_first_regionpcmcia_get_first_tuplepcmcia_get_first_windowpcmcia_get_next_regionpcmcia_get_next_tuplepcmcia_get_next_windowpcmcia_get_statuspcmcia_get_tuple_datapcmcia_insert_cardpcmcia_map_mem_pagepcmcia_modify_configurationpcmcia_modify_windowpcmcia_open_memorypcmcia_parse_tuplepcmcia_read_memorypcmcia_register_clientpcmcia_register_erase_queuepcmcia_register_mtdpcmcia_release_configurationpcmcia_release_iopcmcia_release_irqpcmcia_release_windowpcmcia_replace_cispcmcia_report_errorpcmcia_request_configurationpcmcia_request_iopcmcia_request_irqpcmcia_request_windowpcmcia_reset_cardpcmcia_resume_cardpcmcia_set_event_maskpcmcia_suspend_cardpcmcia_validate_cispcmcia_write_memorydead_socketregister_ss_entryunregister_ss_entryCardServicesMTDHelperEntryproc_pccardpcmcia_register_socketpcmcia_unregister_socketpcmcia_suspend_socketpcmcia_resume_socketusb_ifnum_to_ifusb_epnum_to_ep_descusb_registerusb_deregisterusb_scan_devicesusb_alloc_bususb_free_bususb_register_bususb_deregister_bususb_alloc_devusb_free_devusb_inc_dev_useusb_driver_claim_interfaceusb_interface_claimedusb_driver_release_interfaceusb_root_hub_stringusb_new_deviceusb_reset_deviceusb_connectusb_disconnectusb_check_bandwidthusb_claim_bandwidthusb_release_bandwidthusb_set_addressusb_get_descriptorusb_get_class_descriptor__usb_get_extra_descriptorusb_get_device_descriptorusb_get_stringusb_stringusb_get_protocolusb_set_protocolusb_get_reportusb_set_reportusb_set_idleusb_clear_haltusb_set_interfaceusb_get_configurationusb_set_configurationusb_get_current_frame_numberusb_alloc_urbusb_free_urbusb_submit_urbusb_unlink_urbusb_control_msgusb_bulk_msgskb_over_panicskb_under_panicsock_registersock_unregister__lock_sock__release_sockmemcpy_fromiovecmemcpy_tokerneliovecsock_createsock_allocsock_releasesock_setsockoptsock_getsockoptsock_sendmsgsock_recvmsgsk_allocsk_freesock_wake_asyncsock_alloc_send_skbsock_init_datasock_no_releasesock_no_bindsock_no_connectsock_no_socketpairsock_no_acceptsock_no_getnamesock_no_pollsock_no_ioctlsock_no_listensock_no_shutdownsock_no_getsockoptsock_no_setsockoptsock_no_sendmsgsock_no_recvmsgsock_no_mmapsock_rfreesock_wfreesock_wmallocsock_rmallocskb_recv_datagramskb_free_datagramskb_copy_datagramskb_copy_datagram_iovecskb_copy_expanddatagram_pollput_cmsgsock_kmallocsock_kfree_sneigh_table_initneigh_table_clearneigh_resolve_outputneigh_connected_outputneigh_updateneigh_createneigh_lookup__neigh_event_sendneigh_event_nsneigh_ifdownneigh_sysctl_registerpneigh_lookuppneigh_enqueueneigh_destroyneigh_parms_allocneigh_parms_releaseneigh_rand_reach_timeneigh_compat_outputdst_alloc__dst_freedst_destroynet_ratelimitnet_randomnet_srandom__scm_destroy__scm_sendscm_fp_dupfiles_statmemcpy_toioveccsum_partialsklist_destroy_socketsklist_insert_socketscm_detach_fdsinetdev_lockinet_add_protocolinet_del_protocolip_route_output_keyip_route_inputicmp_sendicmp_replyip_options_compileip_options_undoarp_sendarp_broken_ops__ip_select_identip_send_checkip_fragmentinet_family_opsin_atonip_mc_inc_groupip_mc_dec_groupip_finish_outputinet_dgram_opsip_cmsg_recvinet_addr_typeinet_select_addrip_dev_findinetdev_by_indexin_dev_finish_destroyip_defragip_rt_ioctldevinet_ioctlregister_inetaddr_notifierunregister_inetaddr_notifierip_statisticsdev_set_allmultidev_set_promiscuitysklist_remove_socketrtnl_semrtnl_lockrtnl_unlockipv4_configdev_openin_ntoaip_rcvarp_rcvarp_tblarp_findregister_netdevice_notifierunregister_netdevice_notifierinit_etherdevloopback_devregister_netdeviceunregister_netdeviceregister_netdevunregister_netdevnetdev_state_changeether_setupdev_new_indexdev_get_by_index__dev_get_by_indexdev_get_by_name__dev_get_by_namenetdev_finish_unregisternetdev_set_mastereth_type_transalloc_skb__kfree_skbskb_cloneskb_copynetif_rxdev_add_packdev_remove_packdev_getdev_allocdev_alloc_name__netdev_watchdog_updev_ioctldev_queue_xmitdev_basedev_base_lockdev_closedev_mc_adddev_mc_deletedev_mc_uploadn_tty_ioctltty_register_ldisc__kill_fasyncif_port_textsysctl_wmem_maxsysctl_rmem_maxsysctl_ip_default_ttlqdisc_destroyqdisc_resetqdisc_restartqdisc_create_dfltnoop_qdiscqdisc_tree_lockregister_gifconfnet_call_rx_atomicsoftnet_datarpc_allocaterpc_freerpc_executerpc_init_taskrpc_sleep_onrpc_wake_up_nextrpc_wake_up_taskrpc_new_childrpc_run_childrpciod_downrpciod_uprpc_new_taskrpc_wake_up_statusrpc_create_clientrpc_destroy_clientrpc_shutdown_clientrpc_killall_tasksrpc_call_syncrpc_call_asyncrpc_call_setuprpc_clnt_sigmaskrpc_clnt_sigunmaskrpc_delayrpc_restart_callxprt_create_protoxprt_destroyxprt_set_timeoutrpcauth_registerrpcauth_unregisterrpcauth_init_credcacherpcauth_free_credcacherpcauth_insert_credcacherpcauth_lookupcredrpcauth_bindcredrpcauth_matchcredrpcauth_releasecredsvc_createsvc_create_threadsvc_exit_threadsvc_destroysvc_dropsvc_processsvc_recvsvc_wake_upsvc_makesockrpc_proc_registerrpc_proc_unregisterrpc_proc_readsvc_proc_registersvc_proc_unregistersvc_proc_readxdr_encode_arrayxdr_encode_stringxdr_decode_stringxdr_decode_netobjxdr_encode_netobjxdr_zeroxdr_onexdr_twoxdr_shift_iovecxdr_zero_iovecrpc_successrpc_garbage_argsrpc_system_errrpc_debugnfs_debugnfsd_debugnlm_debug_memcpy_fromio_memcpy_toio_memset_iomemparseget_optionget_optionsp!@t1!Ht111T>1Ԃ1X>1Ԃ1\>1Ԃ1l>1Ԃ1p>1Ԃ1|>1Ԃ1>1Ԃ1>1Ԃ1>1Ԃ1HU!ȫ4U!ԫ4T!4T!4T!4@V!4V! 4S!04`V!<4DL5L4]!X4D^!l4L54`c"4!454${!4z!Ĭ4h%1Ь4|!ج44!4|!4747 47 4M544!D4!L4!X4Tn!h4n!t4747474&14&1ȭ4dA1ܭ4?14T?14HA14@14>147 4D!4!,4C1D4C1L4(D1T4hD1\4D1d4D1l4`61t4LE1|4|E14DF14F14614dH14`414014014G1Į44H1̮4 51Ԯ4:14d7148>1 4 61 4!44!L4(!`4t!p4S14S14S140T14dT14$Ի4p$ܻ40$4B$4C$4A$4B$4H(4.$ 4l<#44XW$D4P$\4T$t4 g$4,R$4T$4tU$ļ4LX$ؼ4K#4HE#4m#4Z#,4|5@46#P4$7l4,7|45454TJ%4K%4$\%̽48V%ܽ4t%4dt%4X%4|{%,4(%44t~%D4%T4%d4`%t4l%4%4%4d$4$о4%ܾ4$4 %4 %4% 4\%4%$4D$04$<49%P48%\47l4?#x4l#4k#4H%4%4<%̿4%ܿ4H54_$4d0% 4$b%,4d%84hy%H4xz%X4\1%h4$x4$4@Q#4U#4U#4>#40'$4'$4\$4$4`(48(,4 o8D4$T4$`40]8l47|40a8474<(4=(4H%42$48&4X$4$4L$4,$47$4D8&448&D485T4d<$\4A$h47x474H.$4b(44k)4h^(4b(4(4(4Ԇ(4e"45(4tl$<4l$P4,$h4$t4$4$4p$4$4$4$4p$4d$4Z"4`["4["44"H4D"`4x"x4D"4p"4H"4H"4"4"4" 4"$4"04hr!<4s!H4p7T4E"`48F"p4tF"4s!4t!4"4L54P54T54L%4%4%4% 4"04#@4#P4#\4Y$l4$R!x4S!48L54t"4"4"4"4H"4"4"45$45446"D4E"P4:"`48;"l49"4@:"41"41"47474W!4`X!4J54747 4]",4`c"44`S1<4L1D4($P4$\4($h4H1t4J5454c!4v!40v!4Tv!4V64(4t(4454<5$4(E"04p$<4$L4`$`4$l4$|4$4!474z$4P3$40%4\54H848)$40e847$ 4H%4t%,4%@4t%T4%d4Р7t4!|4 !4p!4!4h]$454545454*%4,%4 2&4p$ 4Xf"44+ 4?+(4 A+<4,*P4=+l4<*4t*4*4*4*4* 4\;+$4$ +<4*T4<+l4+4*4@*4+4*4*4@*4|*$4>+<4$+P4?+d40*x44=+4\<+4*4*4*4*4| + 4$*44*H4*h4*|4*4l*4*4*4<*4'+4|@+4H'6$4*04*D48+X4,8+h4X'6x4H*4*48*4|*4z+40{+4(x+4'HH2h-'>'H<2-'='020/' A'  2XD'D' 2/'0'L2-'='24'xE'H26' A'@20/'=' 27'='@2`8'='@28'='D26' A'@20/'=' 2:';'(2(-'E' 5222(R'(R'2?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*!!!!/%123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $% $%% %%<%%%$%4%,%%d"e"`":&;&e&f&c&`&" %%%B&@&j&k&<&%%!< %!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~# #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%")"a"e"d" #!#H""" %  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~:&;&e&f&%c&`&" %%%B&@&j&k&<&%%%%!< %!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJK*!LMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#+! #%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%%&!")"a"e"d" #!#H""" %G3G366z7z7ttyS@))l) 1234567890-= qwertyuiop[]asdfghjkl;'`\zxcvbnm,./      <   !@#$%^&*()_+ QWERTYUIOP{}ASDFGHJKL:"~|ZXCVBNM<>?     >     @${[]}\qwrtyuiop~sghjklzxvnm    |                   1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./      <              66666 6 6[[A[[B[[C[[D[[E[17~[18~[19~[20~[21~[23~[24~[25~[26~[28~[29~[31~[32~[33~[34~[1~[2~[3~[4~[5~[6~666 66666%6+61676=6C6I6O6U6[6a6g6m6s6x6}666666`A`a'A'a^A^a~A~a"A"aOAoa0A0aAAaaAEae,C,c`E`e'E'e^E^e"E"e`I`i'I'i^I^i"I"i-D-d~N~n`O`o'O'o^O^o~O~o"O"o/O/o`U`u'U'u^U^u"U"u'Y'yTHthss"yszijD1234567890-= qwertyuiop[] asdfghjkl;'`\zxcvbnm,./* 789-456+1230 /|}~z{YxZ[\]^_|y`abcdqrstuefghi|jvklmno}~pY|Q3eth%d eth%d6 eth%d6 eth%d@6 eth%dl6 eth%d6 eth%d6 eth%d 6 lo"6\ H#6$^3_3_3_3_3_3_3_3 `3`3xV4$p3$*p3p3E*tF*HY*d*PC*ide_cs4P4H@6H"? P4L@6H"P4m66EP496H"FO496H"("GO4:6H"("HO4 :6H"("IO4$:6H"("JO48H"OO4:6H"P|O4:6H"RpO4:6H"ShO48 H"T\O4:6 H"UPO4:6 H"VDO4:6H"W0O4:6H"lO/O/ 0y/@|//H//ć/X/x/v/$/9,,9,W6W GW6W|ELW?Uԙ0)  ~. P!|5|5 5W6W6    }^E$x P ȁ  X 8    l !P!0TJ5(:|J5(D DR:! lM!:!  !O5Z!!g!z!!!h6h6ت 4M!%!!!(!@h!d  !! h6'!3\!tBh!Q!_x!qH!}!dD!!tp!hx!!4"8!L"h6 "$"|#"L6!-"@$5K(5 [H."tj (M!!/"!/"<5@@5 /"0"tP<"D5A"T!E"`5#F"X+G"3K"<DK"(O!Y"]d5gY"q5~5xZ"x!]" ,8C!pM!h6!^"(5, l@C! .xM!Dp6L6V6c,5ql6u! j"~05H\"T|5"|t"pu"w"y"0{" !T"T""܏"!""T("D4!ԝ"!";" M5[!H"e@5q5p"0""6!"ح5"""X"ܭ5!6-< ;LC! UM!k!"t5~5 p5`"4$"405@X"Я55$5, P5 5, 5," "3 6= "4Q "H] 4"Xg "} L" ľ" \" !" !" X"h "p]!" " " !D"!1! 6 !6!6!6!6!$6(!$"8!"R!"`c!4"Xv!5!!l"!5!(6!,6!D !M!!!"!! "!@"! #(! # "X# "#)"#;"8#F"!#M"#["$ #f"##r"%#"!D1#"<5#l"5#P"5#"L9#x":#"=#(">##@##A#2#\K#pB#TL#R#O#n#\U#4#Z##5 #5 #T[##]##^##_##pa# $0b#,$\e#/$e#L;$tg#H$dh#HT$!Dr#_$Dr#q$s#$!y#$y#$|#D$|#$!l#$l#$#$!#$!4#$<5$@5%5d%L5%4#1%06A%,6O%M!m%Б# %#%<#%ș#%`#%!p#% x%8 %  & &T p4&!p#;&!Ԯ#D&Ԯ#T&p#a&X#m&ܵ#v&#&#&5& T&M!&! #& #&!#&5 &5 'ĺ5 !'к5 2'#B'#J'p#^' m'XC! 'M!'!#'ܺ5'!(#'# '4#X'#' 5'$5(!h# (D6!(t5+(#(=(x5F(!$Q($@Z($b($hu(!0$(!D$(<$(!$(h $(!H&$(5(6(&$p(5@(X6(x6)$)$)5@)!)$*)L54)T5>)`5J)!.$S)d5Ad)5t)5)5)5 ) 0$)6)6)5$|)6)5$*86$h4)6*6$D2*6$G*6U*6b*6m*x7$p{*XA$T*(<$<*`$*<$d*<$|*05*d=$p*|D$+6&+62+E$A+G$U+H$b+I$w+J$t+ K$l+xL$l+N$+X$x+X$+b$h,45 ,Te$8%,f$6,P C,M![,!k$c,D5m,d5,k$H,k$H,(l$L, 6,$m$,m$,ln$8,h5,o$,r$,Xt$-p5-0u$-t5@$-5l--`~$8-6K-$W-`$d-,$r- $ -$T-$P-Њ$H-$4-L$-8$-$L-!$-У$-$. 5 .Ĥ$H.P6$.P60. $d7.T6?.`$L.|$@Y.06d.! $k.d5y. $\.|$.$h.!$.h5.L6.$.$$.!8$.$.$.$.$.$/0$`/$/$)/$;/$N/$$`/<$po/$p/$/p$/5/$/P6/ $0/5(/P$/,5 0l h0M!10!$$90D5J0p$pX0$Dd0$0y0|$0%0%x0!!%0!%`0$"%0"%0$%0<%%050(%050T61 \1M!+1! ,%31 ,%>1!d0%H13% S14%<[1p6%xe1!8%n19%|1<% 1=%1A%1tB%1!F%1F%D1F%1F%1!I%151I%h 2X6 .J% 2K%(2 L%042PL%`H2M%l^2O% j29x%J9%\90%p9%9%L9\%959059H59p%:`5@:5@,:%=:5@R: 5@m:%\:`%H:`5@:L%X:!%:5@:%:P%:l%D ;X%;%D.; 6=;(% K;H%$\;5@w;l%; 5;85@;x5@;%;&;!,&;5<,&< & /<!&6<& @<&$M<<&W<T&Ha<!&l<&<&<$6< 6<!D&<D& <P&<&<&l =l&X=&X-= &,==H &M=\#&X_=#&,t=#&X=8$&X=$&X=$&h=P%&p=%&,=%&X=D&&X>&&X>&&h)>\'&<6>(&<D>5@\>(6b>P5r>!(&z>(&H>D-&t>)&6)&8>)&>*&>!1&><5>1&h>D5>6& >N!?!89&?89&0?,6>?!A&D?!A&M?B&_?DC&s?tO&\}?!(P&?H5@?!P&?5?Q&b5!U&?5p?U&?V&$?V&D?!W&?W& @X&p@X&(@ Y&7@!pZ&@@pZ&R@[&  4!d&d@t}&v@e&@Tf&@\g&@4i&0@`p& @p& @p&(@p&@p&DA(s&+1!d&10!l&Al&T)A&5A5GAč&YA؎&eA&pA&0{A&A&@A&A&LAH&A &l[,!x&A06A(5(X&A &tA&A&4 BP5BD 'BN!?B!&IB& WBİ&  4!&hB5(qB&B&tBt&TB0&BȲ& B5 B&dB8& Bн&|B&(C&C&%C&8C5b5!&DC&RCt&aCl&oC&~C&|C&C&`C&C!&C&$C06C&C&XD&D&+D&@D`&@OD&cD&sD(&hD&xD!&D5D&$D<6D &D$&@D@&TE&lE$&+E&XGt'TNG!'UG'gGT'xG'G'G\'G 'xG!'G #'G#'G%'Gd&'` H&'d"H(''2H('@H('QH)'`H*'oHd+'Hl,'H!-'H-'$H(-'@Hh-'H0/'PH/'HH0'I4'DI6'%I7't8I`8'lII8']I:'qI;'8I='I='8I>' I A'8IXD'ID'IxE'$IE'J5J5h*J!G'3Jh5@JK'KJM'4[JI'xoJ!(X;(X6X=(X!N(XN(DX!V(X!V(Xh7X! Z(X Z(dX@5YD5 YZ(Y[(*Y^( ;Y_( MY<_(^YT_($pYx_(zYH5@Yle(Yhf(DYlx(YLt(YPx(Yy(<Y5@Y5Yh(<Yh(<Y$i(XY(Z|m(Z0n('Zl74ZTz(_(`Q_ (l]_x($j_(v_4(_((`_Į(|_@(_X`7_į(_(_(_\`7_``7`d`7`h`70`l`7>`( O`Y7^`Y7h`Y7s`$Z7`(Z7`!l(`\5`l(`d(`P(`(`l(``((`(`|`7``7a`7 a`7a@(\a(`*a(9ad7Ma0(Xa(da|c7sad7a)Da`(a\(a`7a\(0ad7a(aX(a(a(xaT(a(la|(a\(aT(h bL(b (%bd77b(@Cb(@Ob<(HVb(H\b(Hbb(Hhb\(Dtb(b@(b\(bT(bD(b($b (b(xc(<*cX(@Ac(Wc(PpcD(cl(,c(cL5c(c<)\c )\c)(c),d)(d) *d$)>d8)KdH) Zdh)cd )md)vd)<dd7da7db7dd7d)dxd7d$ )pd|d7e )tel )(*e);e )Qe),^e)0med7te!)ed5e)Hed7eh5 ed7ed7e!#)e5e5e5e5f5 f5@f$2)Xf3)4%f1)\-f,4)x4f|2)(m)XLmD)hYm)Dhm)Pwm@)\m)Dm)m)0m)m)Lm)0m)(mw7m@)m@ m Tn,v7nv7%nw75ny7Bny7Qny7gn N!n6nz7n@),n6nl)`n)$n Xn!)o!)o06"o16.o265o)H=oD)XNo8)HVo36'`oZ6ho )lwo6o6o)0o)o)8o o8K! oM!p <pT (&p| 49p Hp!)Op6Wp)ep)Xyp$)p)4p)dp )p)pp4)p)$p!)pz7p!x)pp xp  q6,q6,q@6,$ql6,-q6,6q6,?q 6,Hq"6,!x)Qq <_q rq0 q!x)qx)tq)q)<q)8q!*q*\p`*q!t*Op|$6q$6<q$6qt* r0*Lr|*@!r*2r*l8r*<PrP*ir sr r r$6r *Tr *r@*,r *0r *rl*r* s*s*s!*'s!d *-shj3 ?sd *Ns\!* is$6zsd!lsz7sz7s&*sl**s'*sh)*s**lsX0*` t 3* t4*%t5*P7t7*Et\9*<Ttz7ftz7qt,?*tD*tz7t*6 I+6S+6a+dx +\|+d+dD+X͉+`++h+ <++%+/L+=+pPd+h|+{`+,++ +6<!+ˊH+6@׊8|7+0H|74+|,$+(3+$B+P~7g+~7~7~7~7+0+0+6$Ë+ˋ+,ҋ++~7+X+P$l+8~7J+`+6n+6z+T++x+$+Č+ T+@+,l+,+)$+t5+F$+X+|b+s8+L++0+4+T+hÍD+э+ڍ+`+H+ ++H#+H*+d28+EH+lP+e+q+~+6+6x+++ю+Xڎ$,,H<,0,+6 `,-t,=D38J!X!$,b!$,k,6@{,,h,,0T,,,0) ,,Dŏ$,я,d܏,dA5 t ,0X,6( ,",6/x ,D,6] ,i7rd7~h7,6!,%,,%,7<2,Ɛ6,ې!<,,677B,E,T.!dE,6! M,A M,LQ!lQ,WlQ,c!X,u!X,{h/6l/67X7!K!ܑM!@^, Dc,/6/e,C`f,Qg,|_X7lLk,w l,@Lm,,xn,o,$s,7Ē/6Ӓ!0,ߒ0,<l,!,/6/6/6*/67,B؁7S܁7hĆ,Xt,X,!(,/6(,X,˓,|ۓؖ,,0,,\ 7,@)ܙ,@7,B,|WX, e,4y7!x,!,$46046446Ĕ7є7ܔ!Գ,!K!M!!ȶ,'!ȶ,/ȶ,@E!l,V!l,dt,qt,,,4D,`,X,,|̕m3֕,d,,dH, ,@056@!,?7I!,QX,d,8s,$,8,,`,ΖH7ۖD77,L707",/7;66I7X66d7q 7|7<,66667՗,T,<,`66,,, $,/,LIP7U,tx!T,96(9696 :6h, јT7ݘT,x,<,PX7X,NG!-,- <-,G!-R(:6_@:6lX:6z!`-H-!-:6--Lș\7љ-4ۙD-p--8-0!@-"!$-/!H0-;H0-xP <-0c$I-v:6!L-L-\M-8TM-0ʚM-@ܚ!g-o-`Dr-4t-X-(X-x5Є-HC-X:6b4-r0-x!ܭ-ܭ-LP-D-ě@-՛ȯ-ܰ-<-(ȶ-l!4-7ظ-O-g-{-D-8@-t-Мl-H-x,--$-P*D-?<-QD-<a- w-L--4<-$-ԝ- ܝ--dD-\-|- -8-PM-]-k|-z -P\-D-XH-T-ɞ-מ--.$!.1.DC.T\.a$.zB.!|F.R.D(L.8\V.ΟG.ܟH.J.XJ.P`N.&,O.;`S.L!PY.W,;6b`7lY.|].$_.``.g.̠`h.ܠP@6|L.[/8h/vp/L///p4/x7¥!/̥B64ޥ/H/( /x /" /4<|7K/`[/Ph/u/$/|DB6! /0$/<x&/@ͦ )/lצ,/`1/ 4/#!$N!$!8/+8/58/HF8/HW 9/0jP9/0{X>/!B/xF6|F6§F6ڧB/TLC/ !C/,D/+8K/$5\L/<DM/S,O/@blO/tuO/!P/O6O6h7R/ɨP60٨_/L!,a/0P6,a/07\a/d'b/64P6Hc/Yd/|pg/j/T7m/m/!n/ɩK!שL!L!L!L! %!'!$(!`1(!`@H)! LT*!\(+!(hL!z1!P,!,!87/!Lƪ\/!D֪/!d3!p6!(N!6!(t7!=H9!SM!tM!M! M!ѫ!n/۫@P6n/to/x o/p\p/p9p/hR4q/pcq/{r/;1L;1Yh=1d<1o;1zp<18<1<1@=1=1<1ʽ>1ؽ=1=1     i  i  } E$E !A1!@C1'!@C1/!@C18!H1CI1`M$J1T!S1T!S1T!S1T!0T1T!dT1^Ǧ4hrZ1xZ1dZ1xZ1Z1T!Z1T!,[1^ǧ4hra1xa1,a1@a1Ta1T!a1T!0b1T!Tb1T!b1^Ǩ4T!g1^ǩ4hrn1xn1 n14n1Hn1T!n1^Ǫ4hr0t1s1s1s1D1#xȷ!P5Ҿ,e%@ 0,$@" 05,0%D2<4O4i5@45H 5ͿR6޿` 51/8V%h!,4B6+5P, D]4#L"(5`!t,)$-x)D3#51")HA%N8$cȄ" r+4x5D4 D41`4 |"0$P&0i86d&DX%TYP+hf44 O,Xl/`x0p1X(5$M!466514&?4[C1(b0$,n5""xD'Xl'x8&h55 4 S1@044`5G0f4 |55H 5X'lG0l'(444)A6465L5e&1\<+45 4x45 "#s!$4@ 5Wx 5pT!l}54X405+hD)\ܲ,()pp4A4Spg0e44H10 +d5X"$U.`9)h5`4/!PU'2h4L%`W4 n 14 X55H4 (E"`Ļ4 50\'4K8+X^'kLX$8~!(X44 @,. 5p$D4(47/D\H'Ut4 kX5544855&lt" %L55\4 Ld .([-<k,<w\;+5P4 X5Pg0 4 44 4't%d8 5Qp!lXK-(i:0z5dT15Գ, Ğ'<$4h&4 55?5g5P 54 %844 5 7 0$(-(' @5:$)E5Xd4s@(" 5"t#<p5ȥ#(dg,8 ,Lx"T(,65Dt $(N5h%{ -52*|P'474 7!dY/<6-0/0%;d4 R5$^+k4 ~54x*L05$T!.5.l40%>|5J(Z,|`L"\x$\"(,$6(4L1d&(Th0\.`,$L 35O@5@d5w4  54, 54)$H5/#DP 5fT4 }4K!P(,X5(5 D*4,5G@4 [`4np404 :/(&D4`" |#$|hy% 54;$4UȆ-la!#H8$`M!5@0544 5|*L)4D5V04vP5p'0D,H.$4&(]0$4 hA*4/,|`4 57H"0M\5Z5jL6-x4 45|*0к4 @5 L0t 553,4Sd4 j4X54P5+4  5,4T+'4F`4`%Ho"@{(54 P5(4 :6 P4 4#@i8+4 ?\4W5qxz%5 P55"54B/,4 B4SԳ!`L&o 5Pa,T[( 8/@!$`5 $8"7JHA1O@5j4{4TF0`5L&x74H&84%`5D4`F6k-$|8*D075%4ԡ0g0\P 54!8F"<:6Dx4U:"t^5z*hn-|H5`44 5P 5 544N!C8#1O,[4p5["5]!d'$T<455"B5^4x#|/6'h\4!h@-4 #<*<x&*  ,I0x&h0\98;"J4^4nH,HN00H*<!@<.ĸ$<L45 $*N-7+H<%S4e 66w5*l lm0D44z!<@*<*Hn85 5K4cT<6lx#t~44 47 5 5,#xf', 51%L#485P5R4j9,z0.#) 4 L4K!5`4 @:"45@M&t`h4 s5+5T%478$! 47$<%-784RK!ct!|p7}|S68 54,;6`5$&0!t$,8%h5@H4 \-m54@,d4=+5D4 4 43г%FP5c4],lr#4T-L,T4,$5h^(g*D)!494T| "8_܌0(r@4 4 $ddA1*64  501 ! ('T$4>"L$,\L!f`@5 r$!l|hH&4 T+#HL4d>" H8 @- 5: X 5R 4s P5 $$ p5 5 D ! 4 L4 ,6& 4)H4 )(B 4(t X'd d$ V6 87 % U# |4  h5 H#( . d$% !A 5[ D.,e `5 Ln8 5 5  5 7 8( L4! 40d* 5H $\%X 4y k# x5 H4  61 4*$ m0  8q, 0  X40 H2#<B #L #^ ~,w s!  0X 0. 4 Tn!H X\, ! P&5i"H,%1Pn8= 5M4o54p58@6+*/H0\d4#<74@5Q!`4 w6#H5,6<1lp5)8&Į45-85G&1YT/,n57̚% 066 5@+.@ 4 5l$+5>9%I,,dUdt%h 5O,`E"< "55|'|$4 \ 5'($ 34 G <6a5v 5,4T/8#57,7) 5($4)8:d&E4V<4 i4 ~5#h 5@85@55p50@5P4vT4W!`"8/ $,PR/D,48#X /d$0/H,>5 L`5|5@x8,4545 ď8"`#@5$,I< Xn1b( Hr( 5L:,`5̜+t7#D ,ܿ4664 * 76$b%B4^4n40P55 44t!$X 5@5Z4w*D8#5X455,4 4+p 5F7[H5rT(85 <'T4!TQ*@4%\584Y'$f46"ȏ8dn&55.~+`8X# 4,\4K7RĬ4 e`5{4$4 4 850"X5 V(f'(,l5:x4 Pb(X[Ь4l 4 5)#x585>1$*H05'H47!>/XQ!`^V( stl$T<6Ի4510"<8(T`4H49 BP5Uܒ#g454$4  45,xx505GK!Q5q:,`H51\%h5T4 \1%`Q!t \O& 4* 74 Џ8 @  0S  5f @!p  ,| *  , 4 o,X 4 p, 44! 5$!HP6@4!5P!`5b!(5z!4!t*t!5!5!5!@4 !4%"p 57":6M"4g"(46t"P5"t4 "d)"Tn8"0{'""<")"5#&*#(8B#z$R#05h#l)Dt#5L~###.$4#0#4#^,0#" #$/,# #4$g1H$PP,$6$5L$v!x\$0[,Tn$4$X5$/4$t"L$5$8)$h"$5$5%0X %%% w!&%:66%"G%(lV%5j%4|% E.\%@7% 5%T4%0L%5%O6 & 6 &T D&Z0l%&X4B&p$TT&(x+a&5u&<$&5&85&, X&+P&)&\%&H5'!'4,'"<'!4N'`4`'P4q'5''H'l%,'4'44'!' " (̮4(7((%8($4 N(5n(Q/(6(5(@,(4 (Hd(x(4 ('(4)4 )T, #)t4>)E"tN)@*P`)P.<l)x&w)%)Ե")H%)X(|)05)4)5)5*'6.*D8&>*D4V*L4h*D4 |*85*|O6 *4*L0t*4 *x5@* +4 #+\-2+7=+Q6XL+$Y(\+!+ܻ)h+@!+x4+0l+5+ܷ4,7,̀'1,44J,h&XY,7f,H 5y,4,4 ,4,4,$*,%T-5!-`n8,-@(?-5U-5f-5-)`-&- /0-@#-85-4-!X-)`-H5.D$d. x%.43,t9.p5S.4l.4 .5.Dj*X. 5.0'$.L0d.`5/L,$/9/P4/)C//dK/4o/5/$4/4 /5/@5/l4 00p0 5,0p1,909)E0!O04k0K!v0"<0<40H5050ğ70505 1X@0"1:!210`B1$lM1L=,`]14 p1h41@51@51(5141ȟ72d" 2"<205:2o8F25e2D4 z2'2424+ 24$<252U!|2#2$43@ %344?3 5Y3!r35}34 3*$34 34 3+03,64 \44.484I4T.Y4,n4 04hz!474l'H44 474X544 4/D 5#"45525$<5`h!H55\5&hh5n1r5 g005;"5@55665 j"|5{.l555x66 6,6546*XR6D)Le6:%8o67{6&"6@5656Y(X6h>+|6 ,*p6P50l- 7527@$(@7x 5`7h-/tt7D/7574 7@5757+7(% 8p48|4785X80m8 48<68̟78 58,`8 +@8H59l4 9!8&9t56`49l =9*T9n!a95k9H4}9594 94959$#$9K!9':1` :738:1"%:1".: #?:hr!K:'xY:h5r:1:5:4:0$:5 :4:T$x;ȭ40;b18:;5M;h0XY;;6u;L";` 5;\+t;5;$,X;);7;H@6< -<04@<4]<5z<($<<Pp%<<5<5<"<!@<5<d<$ =\5 = 5#=5?=tP,M=,,^=/\q=@ @=5=\I',=E0h=D4=4 =t+ >$4%>..>04K>П7T>H4 j>+|>X&>"> >7>8@>5>5?D@6?54?D7>?$4G?5g?#$|q?d71?D"@?#$?j-D?z!?;0<?,$?!@x5-@(5N@4k@8o0<z@ 5@L&#l@X5@4 @D"T@@!@x5 A0I$AX5/A,t8A4RA@4nA:6A4A& A5 Ax+@AK(A5 BI"Bb$t,BT+JB&d[B-jB5BM54B5BD"B4 B(8(B4 B %BD" C%CH0-C4GC'HTC)xfCHM0`tCp5CXW$C$dCJ5C5Ct4Cp5D50D4 CD4 VD 4nD#dD_$ D 4 D7D,D,HDdy!PD.D%D4 E040E 7HEH.VE5@kE!{E(4E@ E&E$7EZ#E4 E@+E|E1LE(F/ %FO'9F44IF)aF 5F4F5F#LF 5F\4FL$ F5G G0T$G,a'04Gd4PG4wG5G̰ pG4 GxA. G4GP4GH7H /1 H5H5'HL4FHTJ%VH 5nHA&H4k)HZ"pHPY.dHt4H`R6H04 I)4!IT4 5I))?IP%OI(/h\I"nI#{I`!IP IL$I5I\5I4IY$I`5 J0J"%J! 7J@;6?J)NJ ;,cJ,4{J!JLF,J5J5Jԟ7J4J0|Kh5K 51K 8T ![Td46,fT5T 5T<,`TR5 YTH4 T4T4U,4 U4/U/.ZX 5PZ8>1bZ_0nZ 5Z 4Z5ZT6RZ$1Zl+Z,0 [5#[4;[P/I[b!\[ 4 o[L%D{[X5[!<[4 [/[(5[,6[/\>$T \4\E6@+\4S\Z1@]\5v\'\h#\!d\5\@5\5\$` ]p 5"]t4;]P4X] Ti]"Ls]#]@#]pe&@]5@]!P]5]d" ]!d^T4^W( ,^! :^4V^H#d^,$m^R(8w^x4^<6^5^ 5^p*^4_"!_/6)_T-7_P 5S_96g_d04t_+_(D1@_܊*_ 5_4_5_x4`L& `H4 `^,(`!F`X/1Z`x4 p`85`5`(4`lK!`4`4a ap54a.Ga5[a'ea'ppas1zai-a 5ap7 apd$,a#1(a4 ap 4a5a\4b7b,H)b4 r66Or05er4r0.r7rL5r"4r5r4 r4r|!s5s\,/s4 Fs|$Ps5ps5s6s 5s 5s7stF6s 5s5t!0t0 &t d/t<68t5Xt(<mt8%\{t"tl't8t8tD4t"$t4t4u( 5.u`Y,>u:6Uul4 ku(Luu5u\$u%8u4 u4u7u4 v|4 vP4Cv5[vP7hv#zv4v"<v!Hv4vh4 v4w-w ,|%w5?w4^w4"w̿4w4w2/wQ*pwd.Dw<04 x!(x \,8#x4;xT;60Ix@l-(Sx4 ix:!,}xX5x 4x, xX/,Tx5x4 xdH1pxK!x(Py5&yT!d8y,Hy())`Xy96iy*D{yTb14y4y5yh5y'y5yA*$y5zDO*\z47z|q!Ez8,Tz 5hz 8tz5z05z 5z5z 5{7{`!4{ 0A{h_,K{5h{!}{4 {5{5{̽4{({"{4|4$|%1/|87=|4V|.$4g|#$||8$D|4|4|@@6|05|l4}4)D(}4E}L'pT}5n}1 |}~+X}8 5}P5}5}:6}?1}hT'}4~0d7~4 K~ X~*Lo~4 ~h5~(# ~;6~H4~H 5~*~$4  ,4  @+ ;5Wk,4h4yPJ58,D"5 5$54ܭ4l%@D1T&"80L`0hW4p|:64 \.+7<4ӀD%5! |4 t%|1H!?X4]5rl4 N'5 6+dʁx55p4 ,3$%4:pR5Cв SL0 g8prt$6{5(45ɂ4|'4R6 58L5$ *454 JTo8S4k*%y60.+$T*4 ",Ѓ5x 5 4"4:4V4p4T7h5$`Ȅ0ڄ|"<4h%1 C14@5<*"LF5]4u5 5H'|lQ0|ƅܾ4 څ?#55LK!'05EP4bĖ!\p`o8{5+F1ȏ54 pW' %"&d4 ;P<6G4_P/#nx/X5/5̐*|',G1dP5(5 X594Rĸ4 i5Z/(5X%$ 5+ˑ5:6@5 4'H5/5I5_8l0{+885`!t)Xƒ 5ݒ4 4  x"X$`""-E/<<+DSV!Hc45(66@"(ғ%pۓ*1h5'+"8P5P4 e9!<n4Tv!@h4d8,ǔP!Ҕ`c" ٔ,6hw*@d"@5 -,n$d64 M!#[4wD'2$4@4 5$85ϕ5!A$ :64-5;p4Od$a 5u5p8]&X&Ė(֖D5ۖ@5<"K4],j,4z:6X4.5ڞ,--d7 54 "d4? 4 U$d*6q5}+̰'\4ɟ)4ҟ4 ,ĺ4  $@4 .x5NP5_\5n 6w/@V! 85X5ɠ0o&0Ԡ:6 4& PA-(4)4Bi#\N԰4 e57x5"5ġD+|ϡL5ء*p.x̱4&14NH5ux44 65 5آ5O&X4 h45-%h?6,`UL/6b Lq,!;6J'4 l4ѣLR*Ƞ7/( 5D/h(52X"A4P5c44|0`580*#X@ 5ڤ8,4 5@Q#,P5D4]4lW6xt4 4 4 |F.pʥ!ԥP\#LޥM-lK!"x ) 5' 5=`41D5@[ 5{H!;/5p4h-ɦ'P٦"@S105 4 !4#N4f5{4 5P5§#"Чh5D45"!(55[hW%r710 5p5ĨT!Ш#|ۨT5(4`!PC*T%8X*|2p4J|4g4 ~0=(ص! 5X5˩ 51թ\ )@x4 P0X l4'53 5Pe%_`5x!h 5̇ h0@6˪P+|ڪ855'(8"4F|+pWx5lH#hzT?1/4 !5ӫ8۫4, (0(.T'<66;)J$ %hU%"e,6w8*\(5ˬ5 55($4J4h84 -P$85ŭ8454h*0*5E̠7R(4p5 /4"$pX4̮ 8֮t&H<79, X+|d4+h5CC$lJ(p8Xd4xР7~dF6 54˯4H%x:0|,!5)0 5>@5WL66,d4 {5P/4ð/Ѱ@7ݰ40+ 5T!h,`5D80V`5m448665̱:,ٱ6#*H T+Q!P,74t7CB5P04l4 444 Ʋ(v-0 Ҳ$8޲44D4)X)05;<$F;"d4|!h'̳45Գ 4 X5456@4 '4> 5X 5k@-v7#08(5L$.\ô08״D4 (;6$4 &h$. 4F"Rl0^.hj7xc,"0:6!ŵ$4ߵ""5@D7@$ 5<%EX%V ,b b0mt!dx4 F*4 4˶0N-ض,HLE$Lt/о4 )8415E<4_x"*xt x:64 4 ŷp5@߷,LX5)` 5'x5 4#H<p5Q,d_(rLR,L|!@p#`55Ǹ4WLQ6Xg,0rdR6l$ 5T6P$,.4d*h@5$)$"4 l*2L(B$P*- `5v! ~%h75H,(.`4 4 l0045N4` 5vb.P ;6L4*4A1`X4@4)l/8Ĝ D@8Sw#x`30i50v!$x$6 5'%P5@740 ")"&(Э,9h5S$4l 5}54d/85p$;, &"pZ((5 5=8,M@!_5wP5X57L_0/64L!@55>5\54_, &P5M!H4 5/@5UdK!d05t5}:6,44(M0 x5D"x505F8R5nP5h 5'0|{%55$K-t4  ,|:6((9*48(4R<0(f@5tx57 e* 5(P&l,85#4 `4L0,'4A 5\ԝ"h54 P|!054@14)h5@x0 /056h5L5g&{@ 5# 4*4C,y!L 4#H12[,8BtA,4L9"tc4 zO-5) 5l4#$(0T65(4.8G't@?1G`/LU7c4th%~5(5404+,$)h5["h,TpX$|X4X"< .#/,Ė8=+L4 p70/'lH*6:1L44g`G00yt5d4 5H(0T:)x,66(50 5W6$,R$7%C05f#y5D-(54$x5,+, H5&5D4 [45"5x4W6 4 M5.4@ ,tM!XL8]q8g5x45|4%5T!X7}#d46(4P`+fD!T\"D|-*43$P5 54ȷ4e"x5/4G+YF0Xk4L5xX 5̛" 4`5T4 446&L <4*ĺ*C4\7h5}P6`$4 =6`w.H!"lL@6HE#5"51b((?x,<IH5]4w7.( "|4 x5%54(!@-(\84TX"Ld5~$;6K(<45|.$p%H@9,D"4H53V6G05Z5q6{|@+ &T4748&45 5'+|"%(/ܡ"C%(U-$^7k4 ~(.t 5445Ж8@H"0tF"0.(@"8I:6U`5kh4  !\x5554  5  4H54(!LD XQ4fP#n*8, 5P5 5`["\4P(@/(49C. J $Ul"t^$6 xp4 p45P5*t p؎" 55=5@Iȕ"R 7f 5{ . ,,l 4%$<*5P4555WH5i7w8|,'P85," 55 0*p 0P4 0'p)d2x5P #_4{55t(pȴ4 4!D4 Xf"1`-B85`4 t4 4H8"X4,9,a1P,(U*44(5FZ,^(8#$p5$"p.x4*0@4#  5 !!'0- =#<I.Xp5n!$w#44  "85N0H 5)h"':!74W(5k 4 44 p5-#54 $x>"d#4 &46 5[/`kt#` %(4 $=%x !P*T4( 5r"|P6'4C4b@4 w+4|4$",#5((5؜" /  5!h# 1 5P9,cܷ#dph4 G,55r884 +H78!Ĺ4 $,:!6/ Q4rp5l<#,54d4@4-+4L4n %$(y50]84$`4x4^'",84 $4<( 5VX4h,(yI5+6*H,[150a8 5 5 4*d&Ap5U`4 i!|7;6 0$4w%t l4 84l"<)(5;#$P$66f$||,|V-h `X!554 d) x4( T,"<6 5W P%|i  Dt / (# h5  5 4 5 j*X 7 5% 5D ,TZ X5r +# ['  4%d % 61 >"t D!  5 5 51  S0= ̬ H %l^  5y 5 H=)x E1| ` 5 a1X $L 46@ ) 7 4 4: +K ,(W @1\ h+Do 0$"4{ H%8 $4 ,|  , T4  H#  5 4 8 ( 4K ()TZ "k  5   H4 >#0 j-X *h "< 5 S! LE10 h&4 5,5;8S4p)}#hx5"ph44056"T5784O5cL4 x!t`5.p4 4T654ؓ!'d4 ;%DE5`TQ-n&\#\`-T044!968.ܦ!"J0|0p LE<(TR'6e4 x5|$5844  T4 -" 8805R*d4 !m $v!@4 %5d0% 55 4п,)@&*8:H5RԵ4p045`1 4.;6@5ė 0R6(|!*5 Q5A0* 4 @,6RD-+aO*q8B6 l ,44"4444@ 5'4E,(Q\4 dt%Hsl4F.54x4 44p56P4O0L^P4sT!H5|0dl%/ 5! L5"!T!1#1(@4 U5oX508#5+ r,`U.L54 15E5^5h7r!0)@"p5, p54t"475I05i%lp5z" H5548t4D"X 4%l*"l4 6v$J5f5}73\$7(HH544̒+| L4̤/x0 4I4 \!kt/6~l)Pd=/5 5 !-tx$h5@ 4  4 , 4 B p4Z ,g 85 ,46 Tm'T P5 ,| K! p$t 4 !4)!@@,45!'G!TR0R!4t!8;6!4! !"8!4!85!,<"ȁ""x53" ?"4Q"m'd"Ԯ4 x"#"#4"4"%T" 5"4 "R6(#4"#?63# &, C#/U#!^#5v#/P#D^!,#h5#I' #"T#p#H#!#5$#"$.;$85R$$4 i$,{$@5$d(0$c($;,($4$5$5%H0%Ȯ%-%79%l,4G%4g%h4%4%5%4%`5%Dd.h%5&h##&hb!5&4 H&(?00T&61g&g-Lx&"&5&:6&h4 &4&x4 '<4 '`5<'8E'D4U' :6j' $'t)P'x"'p5'4 '0('P4 '85($0 (81+l (H"1( 2&|;(DK!G(8(\(H5v(+(ԯ4 ($(0e8($"(&((4(5(l4)*D3)H4Z)t4 p)q0`)K%)5)!T),)T4 )L#|)4*44/*5D*Ě.[*,7p*4*l5 *DF1T*88* \*)L*P4*,4 +(5+0't-+H4?+й4 V+5j+|5x+${$+4+!+t$+4+4+[)\ ,pu!$,n!D ,/.,&=, PL,